Bevacizumab
Highest phase reached
Approved
Drug type
Antibody
First approval year
2004
- First approval year
- 2004
- Listing at source
- Listed
- Highest phase reached
- Approved
- Drug type
- Antibody
- Drug name
- Bevacizumab
- abevmy
- Abevmy
- alymsys
- Alymsys
- avastin
- Avastin
- avzivi
- Avzivi
- aybintio
- Aybintio
- equidacent
- Equidacent
- lextemy
- Lextemy
- mvasi
- Mvasi
- onbevzi
- Onbevzi
- oyavas
- Oyavas
- vegzelma
- Vegzelma
- zirabev
- Zirabev
- 1 25mg bevacizumab
- 1.25mg bevacizumab
- 12 igg1
- 12-IGG1
- 2.50mg bevacizumab
- abp 215
- ABP 215
- Abp-215
- alymsys
- Alymsys
- ava 1
- AVA-1
- avastin
- Avastin
- AVASTIN
- Avastin (bevacizumab)
- Avastin (Bevacizumab)
- Avastin(Bevacizumab)
- Avastin®
- Avastin® (bevacizumab)
- avzivi
- Avzivi
- bat 1706
- Bat 1706
- BAT 1706 [WHO-DD]
And 256 more, listed on the interactive page.
- CAS registry numbers
- 216974-75-3
- ChEMBL ID
- CHEMBL1201583
- FDA ingredient codes (UNII)
- 2S9ZZM9Q9V
- L01FG01
- L01XC07
- S01LA04
- S01LA08
Sources for recorded values
- 253337
- 2599041
- Applicant
- GENENTECH
- Approval date
- 26 Feb 2004
- Application number
- BLA125085
- Status
- Authorised
- Status date
- 12 Jan 2005
- Authorisation date
- 12 Jan 2005
- Approved indications
- Bevacizumab in combination with fluoropyrimidine-based chemotherapy is indicated for treatment of adult patients with metastatic carcinoma of the colon or rectum. Bevacizumab in combination with paclitaxel is indicated for first-line treatment of adult patients with metastatic breast cancer. For further information as to human epidermal growth factor receptor 2 (HER2) status. Bevacizumab in combination with capecitabine is indicated for first-line treatment of adult patients with metastatic breast cancer in whom treatment with other chemotherapy options including taxanes or anthracyclines is not considered appropriate. Patients who have received taxane and anthracycline-containing regimens in the adjuvant setting within the last 12 months should be excluded from treatment with Avastin in combination with capecitabine. For further information as to HER2 status. Bevacizumab, in addition to platinum-based chemotherapy, is indicated for first-line treatment of adult patients with unresectable advanced, metastatic or recurrent non-small cell lung cancer other than predominantly squamous cell histology. Bevacizumab, in combination with erlotinib, is indicated for first-line treatment of adult patients with unresectable advanced, metastatic or recurrent non-squamous non-small cell lung cancer with Epidermal Growth Factor Receptor (EGFR) activating mutations. Bevacizumab in combination with interferon alfa-2a is indicated for first line treatment of adult patients with advanced and/or metastatic renal cell cancer. Bevacizumab, in combination with carboplatin and paclitaxel is indicated for the front-line treatment of adult patients with advanced (International Federation of Gynecology and Obstetrics (FIGO) stages III B, III C and IV) epithelial ovarian, fallopian tube, or primary peritoneal cancer.Bevacizumab, in combination with carboplatin and gemcitabine, is indicated for treatment of adult patients with first recurrence of platinum-sensitive epithelial ovarian, fallopian tube or primary peritoneal cancer who have not received prior therapy with bevacizumab or other VEGF inhibitors or VEGF receptor–targeted agents. Bevacizumab in combination with paclitaxel, topotecan, or pegylated liposomal doxorubicin is indicated for the treatment of adult patients with platinum-resistant recurrent epithelial ovarian, fallopian tube, or primary peritoneal cancer who received no more than two prior chemotherapy regimens and who have not received prior therapy with bevacizumab or other VEGF inhibitors or VEGF receptor–targeted agents. Bevacizumab, in combination with paclitaxel and cisplatin or, alternatively, paclitaxel and topotecan in patients who cannot receive platinum therapy, is indicated for the treatment of adult patients with persistent, recurrent, or metastatic carcinoma of the cervix.
- Product number
- EMEA/H/C/000582
- Authorisation holder
- Roche Registration GmbH
- Priority medicines scheme
- No
- Generic
- No
- Biosimilar
- No
- Generic medicines
- 0
- Biosimilar medicines
- 8
- Advanced therapy
- No
- Conditional approval
- No
- Additional monitoring
- No
- Accelerated assessment
- No
- Exceptional circumstances
- No
Therapeutic areas
- Breast Neoplasms
- Carcinoma, Non-Small-Cell Lung
- Carcinoma, Renal Cell
- Colorectal Neoplasms
- Fallopian Tube Neoplasms
- Ovarian Neoplasms
- Peritoneal Neoplasms
- Uterine Cervical Neoplasms
European medicines record
- Patents
- 0
- Designations
- 5
- Earliest recorded loss of exclusivity
- 29 May 2027
- First in class
- No
- Fast track
- Yes
- Breakthrough designation
- Yes
- Orphan designation
- No
- Priority review
- Yes
- Orphan exclusivity
- No
- Accelerated approval
- No
- Availability
- Prescription only
- Pharmacology name
- bevacizumab
- Type
- Antibody
- Drug name stem
- -mab; -mab
- Approval recorded by Guide to Pharmacology
- Yes
Administration routes
- Parenteral
- Action
- Binding
- Action type
- Binding
- Target
- VEGFA
- Gene symbol
- VEGFA
- Affinity units
- pIC50
- Primary target
- Yes
- Mechanism
- Vascular endothelial growth factor A inhibitor
- Action type
- Inhibitor
- Target
- Vascular endothelial growth factor A, long form
- Protein identifier
- P15692
Open Targets mechanisms
- Mechanism
- Vascular endothelial growth factor A inhibitor
- Action type
- Inhibitor
- Target
- Vascular endothelial growth factor A, long form
- Condition
- Leukemia, Lymphocytic, Chronic, B-Cell
- Highest recorded phase
- 2
- Condition identifier
- EFO:0000095
- Subject identifier
- D015451
- Condition
- Lymphoma, Follicular
- Highest recorded phase
- 3
- Condition identifier
- EFO:0000096
- Subject identifier
- D008224
- Condition
- Stomach Neoplasms
- Highest recorded phase
- 3
- Condition identifier
- EFO:0000178
- Subject identifier
- D013274
- Condition
- Carcinoma, Squamous Cell
- Highest recorded phase
- 2
- Condition identifier
- EFO:0000181
- Subject identifier
- D002294
- Condition
- Carcinoma, Hepatocellular
- Highest recorded phase
- 3
- Condition identifier
- EFO:0000182
- Subject identifier
- D006528
- Condition
- Hodgkin Disease
- Highest recorded phase
- 2
- Condition identifier
- EFO:0000183
- Subject identifier
- D006689
- Condition
- Prostatic Neoplasms
- Highest recorded phase
- 3
- Condition identifier
- EFO:0000196
- Subject identifier
- D011471
- Condition
- Myelodysplastic Syndromes
- Highest recorded phase
- 2
- Condition identifier
- EFO:0000198
- Subject identifier
- D009190
- Condition
- Neoplasms, Plasma Cell
- Highest recorded phase
- 2
- Condition identifier
- EFO:0000200
- Subject identifier
- D054219
- Condition
- Adenocarcinoma
- Highest recorded phase
- 3
- Condition identifier
- EFO:0000228
- Subject identifier
- D000230
- Condition
- Adenoma
- Highest recorded phase
- 2
- Condition identifier
- EFO:0000232
- Subject identifier
- D000236
- Condition
- Rhabdomyosarcoma, Alveolar
- Highest recorded phase
- 2
- Condition identifier
- EFO:0000248
- Subject identifier
- D018232
- Condition
- Astrocytoma
- Highest recorded phase
- 2
- Condition identifier
- EFO:0000272
- Subject identifier
- D001254
- Condition
- Breast Neoplasms
- Highest recorded phase
- 4
- Condition identifier
- EFO:0000305
- Subject identifier
- D001943
- Condition
- Carcinoma
- Highest recorded phase
- 2
- Condition identifier
- EFO:0000313
- Subject identifier
- D002277
- Condition
- Glioma
- Highest recorded phase
- 2
- Condition identifier
- EFO:0000326
- Subject identifier
- D005910
- Condition
- Carcinoma, Renal Cell
- Highest recorded phase
- 4
- Condition identifier
- EFO:0000335
- Subject identifier
- D002292
- Condition
- Leukemia, Myelogenous, Chronic, BCR-ABL Positive
- Highest recorded phase
- 2
- Condition identifier
- EFO:0000339
- Subject identifier
- D015464
- Condition
- Adenocarcinoma, Clear Cell
- Highest recorded phase
- 2
- Condition identifier
- EFO:0000348
- Subject identifier
- D018262
- Condition
- Carcinoma, Renal Cell
- Highest recorded phase
- 4
- Condition identifier
- EFO:0000349
- Subject identifier
- D002292
- Condition
- Colorectal Neoplasms
- Highest recorded phase
- 4
- Condition identifier
- EFO:0000365
- Subject identifier
- D015179
- Condition
- Melanoma
- Highest recorded phase
- 2
- Condition identifier
- EFO:0000389
- Subject identifier
- D008545
- Condition
- Lymphoma, Large B-Cell, Diffuse
- Highest recorded phase
- 2
- Condition identifier
- EFO:0000403
- Subject identifier
- D016403
- Condition
- Carcinoma, Endometrioid
- Highest recorded phase
- 2
- Condition identifier
- EFO:0000466
- Subject identifier
- D018269
- Condition
- Stomach Neoplasms
- Highest recorded phase
- 3
- Condition identifier
- EFO:0000503
- Subject identifier
- D013274
And 193 more, listed on the interactive page.
- Condition identifier
- EFO_0000095
- Highest recorded phase
- 2
- Condition identifier
- EFO_0000096
- Highest recorded phase
- 3
- Condition identifier
- EFO_0000181
- Highest recorded phase
- 2
- Condition identifier
- EFO_0000182
- Highest recorded phase
- 3
- Condition identifier
- EFO_0000183
- Highest recorded phase
- 2
- Condition identifier
- EFO_0000198
- Highest recorded phase
- 2
- Condition identifier
- EFO_0000200
- Highest recorded phase
- 2
- Condition identifier
- EFO_0000272
- Highest recorded phase
- 2
- Condition identifier
- EFO_0000280
- Condition identifier
- EFO_0000313
- Highest recorded phase
- 2
- Condition identifier
- EFO_0000348
- Highest recorded phase
- 2
- Condition identifier
- EFO_0000349
- Condition identifier
- EFO_0000365
- Condition identifier
- EFO_0000389
- Highest recorded phase
- 2
- Condition identifier
- EFO_0000503
- Highest recorded phase
- 2
- Condition identifier
- EFO_0000514
- Highest recorded phase
- 2
- Condition identifier
- EFO_0000519
- Condition identifier
- EFO_0000558
- Highest recorded phase
- 2
- Condition identifier
- EFO_0000571
- Highest recorded phase
- 3
- Condition identifier
- EFO_0000574
- Highest recorded phase
- 3
- Condition identifier
- EFO_0000588
- Condition identifier
- EFO_0000616
- Condition identifier
- EFO_0000621
- Highest recorded phase
- 2
- Condition identifier
- EFO_0000632
- Highest recorded phase
- 2
- Condition identifier
- EFO_0000637
- Highest recorded phase
- 2
And 386 more, listed on the interactive page.
- Event
- anaemia
- Reports
- 2,208
- Reporting signal score
- 904.913
- Event
- bone marrow failure
- Reports
- 821
- Reporting signal score
- 970.871
- Event
- diarrhoea
- Reports
- 3,647
- Reporting signal score
- 740.175
- Event
- disease progression
- Reports
- 2,511
- Reporting signal score
- 2,910.6
- Event
- endophthalmitis
- Reports
- 690
- Reporting signal score
- 1,576.28
- Event
- epistaxis
- Reports
- 1,106
- Reporting signal score
- 866.558
- Event
- febrile neutropenia
- Reports
- 1,106
- Reporting signal score
- 737.25
- Event
- gastrointestinal perforation
- Reports
- 561
- Reporting signal score
- 1,480.64
- Event
- hypertension
- Reports
- 3,475
- Reporting signal score
- 3,057.49
- Event
- intestinal perforation
- Reports
- 421
- Reporting signal score
- 692.593
- Event
- mucosal inflammation
- Reports
- 760
- Reporting signal score
- 764.949
- Event
- myelosuppression
- Reports
- 642
- Reporting signal score
- 1,077.88
- Event
- neuropathy peripheral
- Reports
- 1,346
- Reporting signal score
- 846.499
- Event
- neutropenia
- Reports
- 1,974
- Reporting signal score
- 1,045.46
- Event
- neutrophil count decreased
- Reports
- 913
- Reporting signal score
- 834.103
- Event
- palmar-plantar erythrodysaesthesia syndrome
- Reports
- 925
- Reporting signal score
- 1,242.05
- Event
- proteinuria
- Reports
- 1,635
- Reporting signal score
- 3,329.76
- Event
- suspected transmission of an infectious agent via product
- Reports
- 241
- Reporting signal score
- 720.203
- Event
- thrombocytopenia
- Reports
- 1,584
- Reporting signal score
- 714.877
- NCT00005061
- NCT00049088
- NCT00085111
- NCT00095459
- NCT00193622
- NCT00276575
- NCT00357318
- NCT00360360
- NCT00390156
- NCT00395434
- NCT00416637
- NCT00448136
- NCT00458315
- NCT00550927
- NCT00556088
- NCT00586092
- NCT00586443
- NCT00653939
- NCT00781846
- NCT00786669
- NCT00809133
- NCT00811993
- NCT00849550
- NCT00861419
- NCT00888043
And 1,494 more, listed on the interactive page.
- Dose
- 5 mg/kg or 10 mg/kg or 15 mg/kg
- Route
- Intravenous
- How often
- Every 2 weeks or every 3 weeks
Conditions of use
- Administer as an intravenous infusion
- Prodrug
- No
- Chirality
- Single enantiomer
- Inorganic
- No
- Natural product
- No
- Component
- Sequence
- Type
- Protein
- Sequence
- EVQLVESGGGLVQPGGSLRLSCAASGYTFTNYGMNWVRQAPGKGLEWVGWINTYTGEPTYAADFKRRFTFSLDTSKSTAYLQMNSLRAEDTAVYYCAKYPHYYGSSHWYFDVWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHT
- Component
- Light chain
- Type
- Protein
- Sequence
- DIQMTQSPSSLSASVGDRVTITCSASQDISNYLNWYQQKPGKAPKVLIYFTSSLHSGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQYSTVPWTFGQGTKVEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC
- 0069-0315
- 0069-0342
- 50242-060
- 50242-061
- 55513-206
- 55513-207
- 72606-011
- 72606-012
- 82491-025
- 83257-009
- 83257-010
- 70121-1754
- 70121-1755
- 85006-1754
- 85006-1755
Related records
Trials (2,821)
- - IKF/AIO-QUINTIS - Evaluating Fruquintinib in Combination With Tislelizumab in Microsatellite Stable / Proficient Mismatch Repair (MSS/pMMR) Metastatic Colorectal Cancer Without Active Liver Metastases
- "Phase II Study of PET Guided Neoadjuvant Chemotherapy (NAC) and Oncotype Guided Hormonal Therapy of Breast Cancer"
- "Stop Early Age-related Macular Degeneration (AMD) From Vision Loss Eternally" Study
- (PGA) for Platinum-resistant/Refractory, Paclitaxel-Pretreated Recurrent Ovarian and Peritoneal Carcinoma
- 131I-Omburtamab, in Recurrent Medulloblastoma and Ependymoma
- 1st Line Chemotherapy Alone or With Bevacizumab in Treating Older Patients With Metastatic Colorectal Cancer
- 1st Line Treatment of Bevacizumab-Taxane vs Bevacizumab-Exemestane in Metastatic Breast Cancer
- 1stline Study Capecitabine Administered on Continuous Way Plus Oxaliplatin&Bevacizumab Every 2weeks in Metastatic CCR.
- 2-arm Trial of Paclitaxel Plus Bevacizumab vs. Capecitabine Plus Bevacizumab
- 2nd-line Treatment of Metastatic Colorectal Cancer
- 5-Fluorouracil, Bevacizumab, and Radiation Followed by Modified FOLFOX6 and Bevacizumab in Stage II/III Rectal Cancer
- 5-Fluorouracil/Leucovorin (5FU/LV) in Combination With Regorafenib in Patients With Metastatic Colorectal Cancer
- 5-FU, Folinic Acid and Irinotecan (FOLFIRI) Plus Cetuximab Versus FOLFIRI Plus Bevacizumab in First Line Treatment Colorectal Cancer (CRC)
- 5FU/LV, Irinotecan, Temozolomide and Bevacizumab for MGMT Silenced, Microsatellite Stable Metastatic Colorectal Cancer.
- 8 Continuous vs 8 Intermittent Cycles in First and Second Line in HER2/Neu Neg Metastatic Breast Cancer
- 89Zr-bevacizumab PET Imaging in Patients With Neuroendocrine Tumors
- 89Zr-bevacizumab PET Scan in Patients With Relapsing Multiple Myeloma
- 89Zr-Bevacizumab PET/CT Imaging in NF2 Patients
- A 24 Month Phase 2a Open Label, Randomized Study of Avastin®, Lucentis®, or Eylea® (Anti-VEGF Therapy) Administered in Combination With Fovista® (Anti-PDGF BB Pegylated Aptamer)
- A 3-month Study to Assess the Safety and Effectiveness of ONS-5010 in Subjects With Neovascular Age-related Macular Degeneration (AMD)
Approved for (30)
- Adult glioblastoma
- Breast cancer
- Breast carcinoma
- Breast neoplasm
- Cancer
- Cervical adenocarcinoma
- Cervical cancer
- Cervical carcinoma
- Chromophobe renal cell carcinoma
- Clear cell renal carcinoma
- Collecting duct carcinoma
- Colonic neoplasm
- Colorectal adenocarcinoma
- Colorectal cancer
- Colorectal carcinoma
- Colorectal neoplasm
- Fallopian tube cancer
- Fallopian tube carcinoma
- Glioblastoma
- Malignant colon neoplasm
In development for (190)
- Acoustic neuroma Phase 1
- Adenocarcinoma Phase 3
- Adenoma Phase 2
- Adrenal cortex carcinoma Phase 2
- Adult hepatocellular carcinoma Phase 2
- Age-related macular degeneration Phase 3
- Alveolar rhabdomyosarcoma Phase 2
- Alveolar soft part sarcoma Phase 2
- Anaplastic astrocytoma Phase 2
- Anaplastic ependymoma Phase 2
- Anaplastic meningioma Phase 2
- Anaplastic oligodendroglioma Phase 2
- Angiosarcoma Phase 2
- Anterior ischemic optic neuropathy Phase 2
- Arteriovenous malformations of the brain Phase 1
- Aseptic meningitis Phase 1
- Astrocytoma (excluding glioblastoma) Phase 2
- B-cell chronic lymphocytic leukemia Phase 2
- Benign fibrous histiocytoma Phase 2
- Biliary tract cancer Phase 2
Other linked conditions (7)
- Acute leukemia
- Barrett esophagus
- Brain glioma
- Colon carcinoma
- Fallopian tube neoplasm
- Hypopharynx squamous cell carcinoma
- Non-small cell squamous lung carcinoma
Targets (1)
- VEGFA Vascular endothelial growth factor A inhibitor