Tulisokibart
Highest phase reached
Phase 3
Drug type
Antibody
- Listing at source
- Listed
- Highest phase reached
- Phase 3
- Drug type
- Antibody
- Drug name
- Tulisokibart
- Immunoglobulin G1 [234-alanine,235-alanine,329-alanine], anti-(human tumor necrosis factor superfamily protein TNFSF15) (human monoclonal PRA023 γ1-chain), disulfide with human monoclonal PRA023 κ-chain, dimer
- immunoglobulin g1 234 alanine 235 alanine 329 alanine anti human tumor necrosis factor superfamily protein tnfsf15 human monoclonal pra023 γ1 chain disulfide with human monoclonal pra023 κ chain dimer
- immunoglobulin g1 kappa anti homo sapienstnfsf15 tumor necrosis factor tnf superfamily member 15 tl1a vascular endothelial cell growth inhibitor 192 a vegi192a membrane and soluble humanized monoclonal antibody
- immunoglobulin g1 kappa anti homo sapienstnfsf15 tumor necrosis factor tnf superfamily member 15 tl1a vascular endothelial cell growth inhibitor 192 a vegi192a membrane and soluble humanized monoclonal antibody gamma1 heavy chain humanized 1 446 vh homo sapiens ighv1 46 02 80 6 ighd ighj6 01 100 cdr imgt 8 8 9 26 33 51 58 97 105 1 116 homo sapiens ighg1 01 g1m17 1 g1v14 ch2 a1 3 a1 2 g1v4 ch2 a114 ch1 k120 213 117 214 hinge 1 15 215 229 ch2l1 3 a 233 l1 2 a 234 p114 a 328 230 339 ch3 d12 355 l14 357 340 444 chs 445 446 117 446 219 213 disulfide with kappa light chain humanized 1 213 v kappa homo sapiens igkv3d 11 02 85 6 igkj4 01 90 9 cdr imgt 5 3 9 27 31 49 51 88 96 1 106 homo sapiens igkc 01 100 km3 a45 1 152 v101 190 107 213 dimer 225 225 228 228 bisdisulfide produced in chinese hamster ovary cho cells cell line cho dg44 glycoform alfa
- immunoglobulin G1-kappa, anti-[Homo sapiensTNFSF15 (tumor necrosis factor (TNF) superfamily member 15, TL1A, vascular endothelial cell growth inhibitor 192-A, VEGI192A), membrane and soluble], humanized monoclonal antibody; gamma1 heavy chain humanized (1-446) [VH (Homo sapiens IGHV1-46*02 (80.6%) -(IGHD) -IGHJ6*01 (100%), CDR-IMGT [8.8.9](26-33.51-58.97-105)) (1-116) -Homo sapiens IGHG1*01, G1m17,1, G1v14 CH2 A1.3, A1.2, G1v4 CH2 A114 (CH1 K120 (213) (117-214), hinge 1-15 (215-229), CH2L1.3>A (233), L1.2>A (234), P114>A(328) (230-339), CH3 D12 (355), L14 (357) (340-444), CHS (445-446)) (117-446)], (219-213')- disulfide with kappa light chain humanized (1'-213') [V-KAPPA (Homo sapiens IGKV3D-11*02 (85.6%) -IGKJ4*01 (90.9%), CDR-IMGT [5.3.9] (27-31.49-51.88-96)) (1'-106') -Homo sapiens IGKC*01 (100%), Km3 A45.1 (152), V101 (190) (107'- 213')]; dimer (225-225'': 228-228'')-bisdisulfide, produced in Chinese hamster ovary (CHO) cells, cell line CHO-DG44, glycoform alfa
- immunoglobulin G1-kappa, anti-[Homo sapiensTNFSF15(tumor necrosis factor (TNF) superfamily member 15, TL1A, vascular endothelial cell growth inhibitor 192-A, VEGI192A), membrane and soluble], humanized monoclonal antibody
- iv tulisokibart
- IV Tulisokibart
- pra 023
- PRA-023
- pra023
- PRA023
- tulisokibart
- Tulisokibart
- tulisokibart [INN]
- TULISOKIBART [USAN]
- Tulisokibart [WHO-DD]
- tulisokibart inn
- tulisokibart usan
- tulisokibart who dd
- CAS registry numbers
- 2648504-55-4
- ChEMBL ID
- CHEMBL5095370
- FDA ingredient codes (UNII)
- ON09TCS5H3
- First in class
- No
- Orphan designation
- No
- Drug name stem
- -bart
- Condition
- Crohn Disease
- Highest recorded phase
- 3
- Condition identifier
- EFO:0000384
- Subject identifier
- D003424
- Condition
- Colitis, Ulcerative
- Highest recorded phase
- 3
- Condition identifier
- EFO:0000729
- Subject identifier
- D003093
- Condition
- Lung Diseases, Interstitial
- Highest recorded phase
- 1
- Condition identifier
- HP:0006515
- Subject identifier
- D017563
- Condition identifier
- EFO_0000384
- Highest recorded phase
- 3
- Condition identifier
- EFO_0000729
- Highest recorded phase
- 3
- Condition identifier
- EFO_1000710
- Highest recorded phase
- 2
- Condition identifier
- HP_0006515
- Condition identifier
- MONDO_0005011
- Highest recorded phase
- 3
- Condition identifier
- MONDO_0005101
- Highest recorded phase
- 3
- Condition identifier
- MONDO_0006559
- Highest recorded phase
- 2
- Condition identifier
- MONDO_0008383
- Highest recorded phase
- 2
- Condition identifier
- MONDO_0011849
- Highest recorded phase
- 2
- NCT04996797
- NCT06052059
- NCT05013905
- NCT06430801
- Prodrug
- No
- Inorganic
- No
- Natural product
- No
- Component
- Heavy chain
- Type
- Protein
- Sequence
- QVQLVQSGAEVKKPGASVKVSCKASGFDIQDTYMHWVKQRPGQGLEWMGRIDPASGHTKYDPKFQVRVTITRDTSTSTVYLELSSLRSEDTAVYYCARSGGLPDVWGQGTTVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPEAAGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNARTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALAAPTEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
- Component
- Disulfide bridges
- Sequence
- 22-96 $ 22''-96'' $ 23'-87' $ 23'''-87''' $ 133'-193' $ 133'''-193''' $ 143-199 $ 143''-199'' $ 219-213' $ 219''-213''' $ 225-225'' $ 228-228'' $ 260-320 $ 260''-320'' $ 366-424 $ 366''-424''
- Component
- Light chain
- Type
- Protein
- Sequence
- ETVLTQSPGTLSLSPGERATLSCRASSSVSYMYWYQQKPGQAPRPLTYATSNLASGIPDRFSGSGSGTDFTLTISRLEPEDFAVYYCQQWEGNPRTFGGGTKLEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC
- Component
- Glycosylation sites (N)
- Sequence
- 296 $ 296'
Related records
Trials (15)
- A Clinical Study of Tulisokibart (MK-7240) to Treat Radiographic Axial Spondyloarthritis (MK-7240-013)
- A Clinical Study of Tulisokibart (MK-7240) to Treat Rheumatoid Arthritis (RA) (MK-7240-014)
- A Phase 2 Safety and Efficacy Study of Tulisokibart (MK-7240/PRA023) in Subjects With Moderately to Severely Active Ulcerative Colitis (MK-7240-005)
- A Phase 2a Safety and Efficacy Open-Label Study of Tulisokibart (MK-7240/PRA023) in Participants With Moderately to Severely Active Crohn's Disease (MK-7240-006)
- A Study of MK-7240 in Healthy Participants (MK-7240-009)
- A Study of PRA023 in Healthy Volunteers
- A Study to Evaluate Efficacy and Safety of Tulisokibart (MK-7240) in Participants With Moderately to Severely Active Ulcerative Colitis (MK-7240-001)
- A Study to Evaluate the Efficacy and Safety of Tulisokibart (MK-7240) in Participants With Moderate to Severe Crohn's Disease (MK-7240-008)
- Bioavailability of SC Formulation and Japanese Ethnobridging Study for PRA023
- Extension Study of Long-term Safety and Efficacy of Tulisokibart in Participants With Crohn's Disease or Ulcerative Colitis (MK-7240-011)
- Pharmacokinetic (PK) Characterization of Subcutaneous Tulisokibart (MK-7240-010)
- Phase 2 Safety and Efficacy Study of Tulisokibart (MK-7240/PRA023) in Subjects With Systemic Sclerosis Associated With Interstitial Lung Disease (SSc-ILD) (MK-7240-007)
- Single Dose Study of Tulisokibart (MK-7240) in Healthy Chinese Participants (MK-7240-002)
- Study to Evaluate Tulisokibart for Hidradenitis Suppurativa (MK-7240-012)
- Study to Evaluate Tulisokibart in Adults With Psoriatic Arthritis (MK-7240-015)
In development for (4)
- Crohn disease Phase 3
- Hidradenitis suppurativa Phase 2
- Interstitial lung disease Phase 1
- Ulcerative colitis Phase 3