Sirukumab
Highest phase reached
Phase 3
Drug type
Antibody
- Listing at source
- Listed
- Highest phase reached
- Phase 3
- Drug type
- Antibody
- Drug name
- Sirukumab
- cnto 136
- CNTO 136
- CNTO 136 100 mg
- CNTO 136 25 mg
- CNTO 136 50 mg
- CNTO-136
- cnto136
- CNTO136
- immunoglobulin g1 anti human interleukin 6 human monoclonal cnto 136 gamma 1 chain disulfide with human monoclonal cnto 136 kappa chain dimer
- IMMUNOGLOBULIN G1, ANTI-(HUMAN INTERLEUKIN 6) (HUMAN MONOCLONAL CNTO 136 .GAMMA.1-CHAIN), DISULFIDE WITH HUMAN MONOCLONAL CNTO 136 .KAPPA.-CHAIN, DIMER
- sirukumab
- Sirukumab
- Sirukumab (IV infusion)
- sirukumab [INN]
- SIRUKUMAB [JAN]
- SIRUKUMAB [USAN]
- Sirukumab [WHO-DD]
- sirukumab 100 mg
- Sirukumab 100 mg
- sirukumab 50 mg
- Sirukumab 50 mg
- sirukumab inn
- sirukumab jan
- sirukumab usan
- sirukumab who dd
- CAS registry numbers
- 1194585-53-9
- ChEMBL ID
- CHEMBL1743071
- FDA ingredient codes (UNII)
- 640443FU93
- L04AC
- L04AC15
Sources for recorded values
- Status
- application_withdrawn
- Status date
- 26 Oct 2017
- Approved indications
- Treatment of rheumatoid arthritis.
- Product number
- EMEA/H/C/004165
- Authorisation holder
- Janssen-Cilag International NV
- Priority medicines scheme
- No
- Generic
- No
- Biosimilar
- No
- Generic medicines
- 0
- Biosimilar medicines
- 0
- Advanced therapy
- No
- Conditional approval
- No
- Additional monitoring
- No
- Accelerated assessment
- No
- Exceptional circumstances
- No
Therapeutic areas
- Arthritis, Rheumatoid
European medicines record
- Patents
- 0
- Designations
- 1
- First in class
- No
- Fast track
- No
- Breakthrough designation
- No
- Orphan designation
- No
- Priority review
- No
- Orphan exclusivity
- No
- Accelerated approval
- No
- Pharmacology name
- sirukumab
- Type
- Antibody
- Drug name stem
- -mab
- Action
- Binding
- Action type
- Binding
- Target
- IL-6
- Gene symbol
- IL-6
- Median affinity
- 13.43
- Affinity units
- pKd
- Primary target
- Yes
- Mechanism
- Interleukin-6 inhibitor
- Action type
- Inhibitor
- Target
- Interleukin-6
- Protein identifier
- P05231
Open Targets mechanisms
- Mechanism
- Interleukin-6 inhibitor
- Action type
- Inhibitor
- Target
- Interleukin-6
- Condition
- Immune System Diseases
- Highest recorded phase
- 3
- Condition identifier
- EFO:0000540
- Subject identifier
- D007154
- Condition
- Arthritis, Rheumatoid
- Highest recorded phase
- 3
- Condition identifier
- EFO:0000685
- Subject identifier
- D001172
- Condition
- Lupus Erythematosus, Cutaneous
- Highest recorded phase
- 1
- Condition identifier
- EFO:0003834
- Subject identifier
- D008178
- Condition
- Lupus Nephritis
- Highest recorded phase
- 2
- Condition identifier
- EFO:0005761
- Subject identifier
- D008181
- Condition
- Polymyalgia Rheumatica
- Highest recorded phase
- 3
- Condition identifier
- EFO:0008518
- Subject identifier
- D011111
- Condition
- Giant Cell Arteritis
- Highest recorded phase
- 3
- Condition identifier
- EFO:1001209
- Subject identifier
- D013700
- Condition
- Depressive Disorder, Major
- Highest recorded phase
- 2
- Condition identifier
- MONDO:0002009
- Subject identifier
- D003865
- Condition
- Asthma
- Highest recorded phase
- 2
- Condition identifier
- MONDO:0004979
- Subject identifier
- D001249
- Condition
- Lupus Erythematosus, Systemic
- Highest recorded phase
- 1
- Condition identifier
- MONDO:0007915
- Subject identifier
- D008180
- Condition
- Severe Acute Respiratory Syndrome
- Highest recorded phase
- 2
- Condition identifier
- MONDO:0100096
- Subject identifier
- D045169
- Condition identifier
- EFO_0000540
- Condition identifier
- EFO_0000685
- Highest recorded phase
- 3
- Condition identifier
- EFO_0003834
- Highest recorded phase
- 3
- Condition identifier
- EFO_0005761
- Highest recorded phase
- 2
- Condition identifier
- EFO_1001209
- Highest recorded phase
- 3
- Condition identifier
- MONDO_0002009
- Highest recorded phase
- 2
- Condition identifier
- MONDO_0004979
- Highest recorded phase
- 2
- Condition identifier
- MONDO_0005046
- Highest recorded phase
- 4
- Condition identifier
- MONDO_0005282
- Highest recorded phase
- 3
- Condition identifier
- MONDO_0005556
- Highest recorded phase
- 2
- Condition identifier
- MONDO_0007915
- Highest recorded phase
- 1
- Condition identifier
- MONDO_0008383
- Highest recorded phase
- 3
- Condition identifier
- MONDO_0008538
- Highest recorded phase
- 3
- Condition identifier
- MONDO_0019735
- Highest recorded phase
- 3
- Condition identifier
- MONDO_0100096
- Highest recorded phase
- 2
- Event
- abdominal discomfort
- Reports
- 20
- Reporting signal score
- 35.213
- Event
- abdominal distension
- Reports
- 72
- Reporting signal score
- 256.094
- Event
- alopecia
- Reports
- 19
- Reporting signal score
- 32.2439
- Event
- anti-cyclic citrullinated peptide antibody positive
- Reports
- 19
- Reporting signal score
- 89.7839
- Event
- arthralgia
- Reports
- 42
- Reporting signal score
- 61.7548
- Event
- arthritis
- Reports
- 94
- Reporting signal score
- 384.813
- Event
- bone erosion
- Reports
- 94
- Reporting signal score
- 650.911
- Event
- c-reactive protein increased
- Reports
- 19
- Reporting signal score
- 48.2321
- Event
- condition aggravated
- Reports
- 19
- Reporting signal score
- 17.4628
- Event
- crohn's disease
- Reports
- 17
- Reporting signal score
- 38.0498
- Event
- decreased appetite
- Reports
- 17
- Reporting signal score
- 20.367
- Event
- discomfort
- Reports
- 17
- Reporting signal score
- 45.2802
- Event
- dizziness
- Reports
- 28
- Reporting signal score
- 23.9657
- Event
- drug hypersensitivity
- Reports
- 29
- Reporting signal score
- 36.6304
- Event
- drug intolerance
- Reports
- 57
- Reporting signal score
- 159.945
- Event
- drug-induced liver injury
- Reports
- 10
- Reporting signal score
- 20.8153
- Event
- dyspepsia
- Reports
- 74
- Reporting signal score
- 272.88
- Event
- ear infection
- Reports
- 17
- Reporting signal score
- 53.8954
- Event
- exostosis
- Reports
- 94
- Reporting signal score
- 576.983
- Event
- fatigue
- Reports
- 43
- Reporting signal score
- 40.2834
- Event
- foot deformity
- Reports
- 94
- Reporting signal score
- 554.862
- Event
- gastric disorder
- Reports
- 70
- Reporting signal score
- 321.213
- Event
- general physical health deterioration
- Reports
- 106
- Reporting signal score
- 412.024
- Event
- glossodynia
- Reports
- 19
- Reporting signal score
- 67.9476
- Event
- hand deformity
- Reports
- 19
- Reporting signal score
- 75.7271
And 38 more, listed on the interactive page.
- NCT00718718
- NCT01604343
- NCT01606761
- NCT01636557
- NCT01689532
- NCT01856309
- NCT02019472
- NCT01273389
- NCT01702740
- NCT02473289
- NCT02531633
- NCT02794519
- NCT02899026
- NCT04380961
- Prodrug
- No
- Chirality
- Single enantiomer
- Inorganic
- No
- Natural product
- No
- Component
- Light chain
- Type
- Protein
- Organism
- Homo sapiens
- Sequence
- EIVLTQSPATLSLSPGERATLSCSASISVSYMYWYQQKPGQAPRLLIYDMSNLASGIPARFSGSGSGTDFTLTISSLEPEDFAVYYCMQWSGYPYTFGGGTKVEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC
- Component
- Heavy chain
- Type
- Protein
- Organism
- Homo sapiens
- Sequence
- EVQLVESGGGLVQPGGSLRLSCAASGFTFSPFAMSWVRQAPGKGLEWVAKISPGGSWTYYSDTVTGRFTISRDNAKNSLYLQMNSLRAEDTAVYYCARQLWGYYALDIWGQGTTVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
Related records
Trials (40)
- A FIH Study to Assess the Safety and Tolerability of NS Intravenous NS101 Infusion
- A Phase 2a Study to Evaluate the Effects of Sirukumab in Subjects With Severe Poorly Controlled Asthma
- A Study Comparing Sirukumab (CNTO 136) Monotherapy With Adalimumab (HUMIRA®) Monotherapy in the Treatment of Active Rheumatoid Arthritis
- A Study of AK129 in Patients With Advanced Malignant Tumors
- A Study of CNTO 136 (Sirukumab) Administered Subcutaneously in Japanese Patients With Active Rheumatoid Arthritis Unresponsive to Methotrexate or Sulfasalazine
- A Study of CNTO 136 (Sirukumab), a Human Anti-IL-6 Monoclonal Antibody, Administered Subcutaneously, in Patients With Active Rheumatoid Arthritis Despite Anti-TNF-Alpha Therapy (SIRROUND-T)
- A Study of CNTO 136 (Sirukumab), Administered Subcutaneously, in Patients With Active Rheumatoid Arthritis Despite Disease-Modifying Antirheumatic Drug (DMARD) Therapy (SIRROUND-D)
- A Study of Effectiveness and Safety of CNTO 136 in Patients With Active Rheumatoid Arthritis Despite Methotrexate Therapy
- A Study of LBP-EC01 in the Treatment of Acute Uncomplicated UTI Caused by Drug Resistant E. Coli (ELIMINATE Trial)
- A Study of MEDI7352 in Painful Osteoarthritis of the Knee
- A Study of PGN-EDO51 or Placebo in People With Duchenne Muscular Dystrophy Amenable to Exon 51-Skipping Treatment
- A Study of the Safety and How the Body Effects a Drug CNTO 136 in Healthy Male Japanese and Caucasian Volunteers
- A Study of the Safety and Pharmacokinetics of CNTO 136 in Patients With Cutaneous Lupus Erythematosus and Systemic Lupus Erythematosus
- A Study to Evaluate the Effect of a Single Dose of CNTO 136 (Sirukumab) on CYP450 Enzyme Activities After Subcutaneous Administration in Patients With Rheumatoid Arthritis
- A Study to Evaluate the Efficacy and Safety of Sirukumab in Confirmed Severe or Critical Confirmed Coronavirus Disease (COVID)-19
- Absolute BA and OZ439 PK Effect of Different OZ439 Dose Volumes and Cobicistat Co-administration Study
- Acetaminophen in aSAH to Inhibit Lipid Peroxidation and Cerebral Vasospasm
- An Efficacy and Safety Study of CNTO 136 in Patients With Active Lupus Nephritis
- An Efficacy and Safety Study of Sirukumab in Participants With Major Depressive Disorder
- Bioavailability and Pharmacokinetics Study of Sirukumab in Healthy Male Participants
In development for (10)
- Asthma Phase 2
- COVID-19 Phase 2
- Cutaneous lupus erythematosus Phase 1
- Immune system disorder Phase 3
- Lupus nephritis Phase 2
- Major depressive disorder Phase 2
- Polymyalgia rheumatica Phase 3
- Rheumatoid arthritis Phase 3
- Systemic lupus erythematosus Phase 1
- Temporal arteritis Phase 3
Targets (1)
- IL6 Interleukin-6 inhibitor