Siltartoxatug
Highest phase reached
Phase 3
Drug type
Antibody
- Listing at source
- Listed
- Highest phase reached
- Phase 3
- Drug type
- Antibody
- Drug name
- Siltartoxatug
- h gamma1 heavy chain homo sapiens 1 448 vh homo sapiens ighv4 34 09 86 6 ighd ighj4 01 100 cdr imgt 8 7 12 26 33 51 57 96 107 1 118 homo sapiens ighg1 03 100 g1m3 ng1m1 ch1 r120 ch3 e12 m14 ch1 r120 215 119 216 hinge 1 15 217 231 ch2 232 341 ch3 e12 357 m14 359 342 446 chs 447 448 119 448 221 214 disulfide with l kappa light chain homo sapiens 1 214 v kappa homo sapiens igkv1 5 03 90 4 igkj2 01 100 cdr imgt 6 3 9 27 32 50 52 89 97 1 107 homo sapiens igkc 01 100 km3 a45 1 153 v101 191 108 214 dimer 227 227 230 230 bisdisulfide produced in chinese hamster ovary cho cells cell line cho k1 lacking the glutamine synthetase gs ko gene glycoform alfa produced in chinese hamster ovary cho cells cell line chok1 lacking the glutamine synthetase gs ko gene glycoform alfa
- H-gamma1 heavy chain Homo sapiens (1-448) [VH (Homo sapiens IGHV4-34*09 (86.6%) -(IGHD) -IGHJ4*01 (100%), CDR-IMGT [8.7.12] (26-33.51-57.96-107)) (1-118) -Homo sapiens IGHG1*03 (100%), G1m3, nG1m1 CH1 R120, CH3 E12, M14 (CH1 R120 (215) (119-216), hinge 1-15 (217-231), CH2 (232-341), CH3 E12 (357), M14 (359) (342-446), CHS (447-448)) (119-448)], (221-214')-disulfide with L-kappa light chain Homo sapiens (1'-214') [V-KAPPA (Homo sapiens IGKV1-5*03 (90.4%) -IGKJ2*01 (100%), CDR-IMGT [6.3.9] (27'-32'.50'-52'.89'-97')) (1'-107') -Homo sapiens IGKC*01 (100%), Km3, A45.1 (153'), V101 (191') (108'-214')]; dimer (227-227'':230-230'')-bisdisulfide, produced in Chinese hamster ovary (CHO) cells, cell line CHO-K1 lacking the glutamine synthetase (GS-KO) gene, glycoform alfa, produced in Chinese hamster ovary (CHO) cells, cell line CHOK1 lacking the glutamine synthetase (GS-KO) gene, glycoform alfa
- immunoglobulin g1 anti tetanus toxin human monoclonal tnm002 γ1 chain disulfide with human monoclonal tnm002 κ chain dimer
- immunoglobulin g1 kappa anti clostridium tetani tetanus toxin tent homo sapiens monoclonal antibody
- immunoglobulin G1-kappa, anti-[Clostridium tetani tetanus toxin (TeNT)], Homo sapiens monoclonal antibody
- Immunoglobulin G1, anti-(tetanus toxin) (human monoclonal TNM002 γ1-chain), disulfide with human monoclonal TNM002 κ-chain, dimer
- siltartoxatug
- Siltartoxatug
- siltartoxatug [INN]
- siltartoxatug injection
- Siltartoxatug Injection
- Siltartoxatug Injection (Brand name: Sintetol®)
- siltartoxatug injection brand name sintetol
- siltartoxatug inn
- tnm 002
- TNM-002
- tnm002
- Tnm002
- TNM002
- tnm002 high dose
- tnm002 medium dose
- CAS registry numbers
- 2841700-23-8
- ChEMBL ID
- CHEMBL6068174
- FDA ingredient codes (UNII)
- E6R33YNF4L
- First in class
- No
- Orphan designation
- No
Investigated indications
- Condition
- Tetanus
- Highest recorded phase
- 3
- Condition identifier
- EFO:0005593
- Subject identifier
- D013742
Open Targets indications
- Condition identifier
- EFO_0005593
- Highest recorded phase
- 3
Trial references
- NCT05664750
- Prodrug
- No
- Chirality
- Single enantiomer
- Inorganic
- No
- Natural product
- No
- Component
- Heavy chain
- Type
- Protein
- Sequence
- QVQLQESGAGLVKPSETLSLTCGVAGGPFTGSYLSWIRQPPGKGLEWIGEVSQSGSTSYNPSLKSRVTISVDTSKSQFSLKLSSVTAADTAVYYCARLTKHYINSAYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
- Component
- Light chain
- Type
- Protein
- Sequence
- DIQMTQSPSILSASVGDRVTITCRASQIIGSWLAWYQQKPGKAPTLVIYKASRLDSGVPSRFSGTESGTEFTLTISSLQPDDFATYYCQQYNSYPYTFGQGTKLEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC
- Component
- Disulfide bridges
- Sequence
- 22-95 $ 22''-95'' $ 23'-88' $ 23'''-88''' $ 134'-194' $ 134'''-194''' $ 145-201 $ 145''-201'' $ 221-214' $ 221''-214''' $ 227-227'' $ 230-230'' $ 262-322 $ 262''-322'' $ 368-426 $ 368''-426''
- Component
- Glycosylation sites (N)
- Sequence
- 298 $ 298''
Related records
Trials (11)
- A Phase 4 Study to Evaluate the Effectiveness and Safety of Siltartoxatug Injection for Tetanus Prophylaxis Following Injury
- A Randomized, Open-Label, Parallel-Design Pharmacokinetic and Pharmacodynamic Interaction Study of TNM002 and Adsorbed Tetanus Vaccine
- A Registry： Siltartoxatug Injection for Tetanus Prophylaxis Following Injury
- A Study of TNM001 in Chinese Healthy Preterm and Term Infants
- A Sudy to Evaluate the Efficacy and Safety of TNM001 in High-risk Infants
- A Trial to Evaluate the Efficacy and Safety of TNM001 for the Prevention of Lower Respiratory Tract Infection Caused by Respiratory Syncytial Virus in Infants
- Clinical Trial to Evaluate the Safety, Tolerability, Pharmacokinetics, and Pharmacodynamics of Recombinant Human Anti-Tetanus Toxin Monoclonal Antibody Injection
- Safety, Tolerability, Pharmacokinetics and Pharmacodynamics of TNM002 in Chinese Healthy Adults
- Safety, Tolerability, Pharmacokinetics and Pharmacodynamics of TNM002 in Healthy Adults
- Study to Compare the Anti-tetanus Neutralizing Antibody Titers and Safety of TNM002 Injection With Human Tetanus Immunoglobulin or Placebo in Adult Volunteers
- Study to Compare the Efficacy and Safety of Passive Immunization With TNM002 Injection and Human Tetanus Immunoglobulin as Prophylaxis Against Tetanus
In development for (1)
- Tetanus Phase 3