Patritumab deruxtecan
Highest phase reached
Phase 3
Drug type
Antibody drug conjugate
- Listing at source
- Listed
- Highest phase reached
- Phase 3
- Drug type
- Antibody drug conjugate
- Drug name
- Patritumab deruxtecan
- anti her3 antibody drug conjugate u3 1402
- ANTI-HER3 ANTIBODY-DRUG CONJUGATE U3 1402
- immunoglobulin g1 anti human epidermal growth factor receptor her3 human monoclonal u3 1287 γ1 chain complex with human monoclonal u3 1287 κ chain dimer octakis thioether with n 6 3 mercapto 2 5 dioxo 1 pyrrolidinyl 1 oxohexyl glycylglycyl l phenylalanyl n 2 1s 9s 9 ethyl 5 fluoro 2 3 9 10 13 15 hexahydro 9 hydroxy 4 methyl 10 13 dioxo 1h 12h benzo de pyrano 3 4 6 7 indolizino 1 2 b quinolin 1 yl amino 2 oxoethoxy methyl glycinamide
- immunoglobulin g1 kappa anti homo sapiens erbb3 receptor tyrosine protein kinase erbb 3 her3 homo sapiens monoclonal antibody conjugated to deruxtecan comprising a linker and a camptothecin derivative gamma1 heavy chain homo sapiens 1 447 vh homo sapiens ighv4 34 01 99 0 ighd ighj2 01 100 8 7 11 1 117 homo sapiens ighg1 03 100 g1m3 ng1m1 ch1 r120 214 118 215 hinge 1 15 216 230 ch2 231 340 ch3 e12 356 m14 358 341 445 chs 446 447 123 452 220 220 disulfide with kappa light chain homo sapiens 1 220 v kappa homo sapiens igkv4 1 01 95 0 igkj1 01 100 12 3 9 1 113 homo sapiens igkc 01 100 km3 a45 1 159 v101 197 114 220 dimer 226 226 229 229 bisdisulfide produced in chinese hamster ovary cho cell line glycoform alfa conjugated on an average of 8 cysteinyl to deruxtecan comprising a linker and a camptothecin derivative
- Immunoglobulin G1-kappa, anti-[Homo sapiens ERBB3 (receptor tyrosine-protein kinase erbB-3, HER3)], Homo sapiens monoclonal antibody, conjugated to deruxtecan, comprising a linker and a camptothecin derivative; gamma1 heavy chain Homo sapiens (1-447) [VH (Homo sapiens IGHV4-34*01 (99.0%) -(IGHD) - IGHJ2*01 (100%)) [8.7.11] (1-117) - Homo sapiens IGHG1*03 (100%) G1m3, nG1m1 (CH1 R120 (214) (118-215), hinge 1-15 (216-230), CH2 (231-340), CH3 E12 (356), M14 (358) (341-445), CHS (446-447)) (123-452)], (220-220')-disulfide with kappa light chain Homo sapiens (1'-220') [V-KAPPA (Homo sapiens IGKV4-1*01 (95.0%) -IGKJ1*01 (100%)) [12.3.9] (1'-113') - Homo sapiens IGKC*01 (100%) Km3 A45.1 (159), V101 (197) (114'-220')]; dimer (226-226'':229-229'')-bisdisulfide, produced in Chinese Hamster Ovary (CHO) cell line, glycoform alfa; conjugated, on an average of 8 cysteinyl, to deruxtecan, comprising a linker and a camptothecin derivative
- Immunoglobulin G1, anti-(human epidermal growth factor receptor HER3) (human monoclonal U3-1287 γ1-chain), complex with human monoclonal U3-1287 κ-chain, dimer, octakis(thioether) with N-[6-(3-mercapto-2,5-dioxo-1-pyrrolidinyl)-1-oxohexyl]glycylglycyl-L-phenylalanyl-N-[[2-[[(1S,9S)-9-ethyl-5-fluoro-2,3,9,10,13,15-hexahydro-9-hydroxy-4-methyl-10,13-dioxo-1H,12H-benzo[de]pyrano[3′,4′:6,7]indolizino[1,2-b]quinolin-1-yl]amino]-2-oxoethoxy]methyl]glycinamide
- patritumab deruxtecan
- Patritumab deruxtecan
- Patritumab Deruxtecan
- Patritumab Deruxtecan (Fixed dose)
- Patritumab Deruxtecan (Up-Titration)
- patritumab deruxtecan [INN]
- PATRITUMAB DERUXTECAN [JAN]
- PATRITUMAB DERUXTECAN [USAN]
- Patritumab deruxtecan [WHO-DD]
- patritumab deruxtecan inn
- patritumab deruxtecan jan
- patritumab deruxtecan usan
- patritumab deruxtecan who dd
- u3 1402
- U3 1402
- u3 1402a
- U3-1402
- U3-1402A
- u31402
And 1 more, listed on the interactive page.
- ATC classification codes
- L01FX36
Sources for recorded values
- CAS registry numbers
- 2227102-46-5
- ChEMBL ID
- CHEMBL4594611
- FDA ingredient codes (UNII)
- 3XPI7EG4W8
- Patents
- 0
- Designations
- 1
- First in class
- No
- Fast track
- No
- Breakthrough designation
- Yes
- Orphan designation
- No
- Priority review
- No
- Orphan exclusivity
- No
- Accelerated approval
- No
- Pharmacology name
- patritumab deruxtecan
- Type
- Antibody
- Drug name stem
- -mab; -tecan
- Mechanism
- Receptor tyrosine-protein kinase erbB-3 binding agent
- Action type
- BINDING_AGENT
- Target
- Receptor tyrosine-protein kinase erbB-3
- Protein identifier
- P21860
- Action
- Binding
- Action type
- Binding
- Target
- erb-b2 receptor tyrosine kinase 3
- Gene symbol
- ERBB3
- Protein identifier
- P21860
- Affinity units
- pKd
- Mechanism
- DNA topoisomerase I inhibitor
- Action type
- Inhibitor
- Target
- DNA topoisomerase 1
- Protein identifier
- P11387
- Mechanism
- Receptor tyrosine-protein kinase erbB-3 binding agent
- Action type
- BINDING AGENT
- Target
- Receptor tyrosine-protein kinase erbB-3
- Mechanism
- DNA topoisomerase I inhibitor
- Action type
- Inhibitor
- Target
- DNA topoisomerase 1
- Condition
- Breast Neoplasms
- Highest recorded phase
- 2
- Condition identifier
- EFO:0000305
- Subject identifier
- D001943
- Condition
- Neoplasms
- Highest recorded phase
- 3
- Condition identifier
- EFO:0000616
- Subject identifier
- D009369
- Condition
- Carcinoma, Non-Small-Cell Lung
- Highest recorded phase
- 2
- Condition identifier
- EFO:0003060
- Subject identifier
- D002289
- Condition
- Breast Neoplasms
- Highest recorded phase
- 2
- Condition identifier
- MONDO:0007254
- Subject identifier
- D001943
- Condition identifier
- EFO_0000305
- Condition identifier
- EFO_0000616
- Condition identifier
- EFO_0003060
- Highest recorded phase
- 2
- Condition identifier
- EFO_1001480
- Highest recorded phase
- 2
- Condition identifier
- MONDO_0001056
- Highest recorded phase
- 2
- Condition identifier
- MONDO_0002974
- Highest recorded phase
- 2
- Condition identifier
- MONDO_0003219
- Highest recorded phase
- 1
- Condition identifier
- MONDO_0004986
- Highest recorded phase
- 2
- Condition identifier
- MONDO_0004992
- Condition identifier
- MONDO_0005028
- Highest recorded phase
- 1
- Condition identifier
- MONDO_0005036
- Highest recorded phase
- 1
- Condition identifier
- MONDO_0005070
- Highest recorded phase
- 4
- Condition identifier
- MONDO_0005105
- Highest recorded phase
- 2
- Condition identifier
- MONDO_0005140
- Highest recorded phase
- 2
- Condition identifier
- MONDO_0005192
- Highest recorded phase
- 2
- Condition identifier
- MONDO_0005212
- Highest recorded phase
- 1
- Condition identifier
- MONDO_0005233
- Highest recorded phase
- 3
- Condition identifier
- MONDO_0005575
- Highest recorded phase
- 2
- Condition identifier
- MONDO_0007254
- Highest recorded phase
- 2
- Condition identifier
- MONDO_0007254
- Highest recorded phase
- 3
- Condition identifier
- MONDO_0008315
- Highest recorded phase
- 2
- Condition identifier
- MONDO_0008903
- Highest recorded phase
- 2
- Condition identifier
- MONDO_0010150
- Highest recorded phase
- 2
- Condition identifier
- MONDO_0011962
- Highest recorded phase
- 2
- Condition identifier
- MONDO_0018666
- Highest recorded phase
- 1
And 1 more, listed on the interactive page.
- NCT02980341
- NCT04610528
- NCT04699630
- NCT04965766
- NCT05569811
- NCT06298084
- NCT04619004
- NCT06383884
- Prodrug
- No
- Chirality
- Single enantiomer
- Inorganic
- No
- Natural product
- No
- Component
- Disulfide bridges
- Sequence
- 22-95 $ 22''-95'' $ 23'-94' $ 23'''-94''' $ 140'-200' $ 140'''-200''' $ 144-200 $ 144''-200'' $ 220-220' $ 220''-220''' $ 226-226'' $ 229-229'' $ 261-321 $ 261''-321'' $ 367-425 $ 367''-425''
- Component
- Light chain
- Type
- Protein
- Sequence
- DIEMTQSPDSLAVSLGERATINCRSSQSVLYSSSNRNYLAWYQQNPGQPPKLLIYWASTRESGVPDRFSGSGSGTDFTLTISSLQAEDVAVYYCQQYYSTPRTFGQGTKVEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC
- Component
- Heavy chain
- Type
- Protein
- Sequence
- QVQLQQWGAGLLKPSETLSLTCAVYGGSFSGYYWSWIRQPPGKGLEWIGEINHSGSTNYNPSLKSRVTISVETSKNQFSLKLSSVTAADTAVYYCARDKWTWYFDLWGRGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
- Component
- Glycosylation sites (N)
- Sequence
- 297 $ 297''
Related records
Trials (106)
- 26-week Open Study of telmisartan40mg+amlodipine10mg or telmisartan80mg+amlodipine10 mg in Hypertension
- A Clinical Study of MK-1084 With Other Treatments for Non-small Cell Lung Cancer (MK-3475-01F)
- A Clinical Study of Patritumab Deruxtecan to Treat Breast Cancer (MK-1022-016)
- A Pharmacodynamic Study to Evaluate the Effect of a Fixed Dose Combination Pill on Low Density Lipoprotein (LDL) Cholesterol
- A Phase Ib/II Study of SYS6090 Combination Therapy in Advanced Colorectal Cancer
- A Phase II, Multicenter, Open-label Study to Evaluate the Efficacy and Safety of Neoadjuvant Therapy With Inavolisib Plus Pertuzumab and Trastuzumab as Subcutaneous (PH-FDC SC) and 3-week Cycle Nab-paclitaxel for PIK3CA-mutated, HER2+, eBC
- A Study Assessing a Range of Formulations of the Fixed Dose Combination Product Containing Dutasteride (0.5mg) and Tamsulosin Hydrochloride (0.2mg) to Find a Formulation Which is Bioequivalent to Harnal-D Tablets (Tamsulosin Hydrochloride, 0.2mg) in Healthy Male Subjects From North East Asia
- A Study in Healthy Male Subjects to Investigate the Comparability of Pharmacokinetics of the Fixed-Dose Combination of Pertuzumab and Trastuzumab Administered Subcutaneously Using a Handheld Syringe or Using the On-Body Delivery System
- A Study of Combogesic® IV (Intravenous) in Pediatric Patients With Acute Pain
- A Study of Patritumab Deruxtecan (HER3-DXd) in Combination With Trastuzumab Deruxtecan (T-DXd) in Participants With HR-Positive, HER2-Low or HER2-Ultralow Unresectable or Metastatic Breast Cancer
- A Study of Patritumab Deruxtecan in Pediatric Participants With Relapsed or Refractory Solid Tumors (MK-9999-01C/LIGHTBEAM-U01)
- A Study of U3-1402 (Patritumab Deruxtecan) in Subjects With Metastatic Breast Cancer
- A Study to Evaluate Patient Preference for Home Administration of Fixed-Dose Combination of Pertuzumab and Trastuzumab for Subcutaneous Administration in Participants With Early or Locally Advanced/Inflammatory HER2-Positive Breast Cancer
- A Study to Evaluate U3-1402 in Subjects With Advanced or Metastatic Colorectal Cancer
- A Trial to Learn if Fianlimab and Cemiplimab Are Safe and Work Better Than Anti-PD1 Alone in Adult Participants With Resectable Stage 3 or 4 Melanoma
- A Window of Opportunity Study of Patritumab Deruxtecan in Patients With Brain Metastases
- A Window-of-opportunity Study of U3-1402, a HER3-targeting Antibody-drug Conjugate in Operable Breast Cancer According to ERBB3 Expression
- ALTAIR - Alternative Antiretroviral Strategies : a Comparison of Three Initial Regimens
- Assessing the Benefits of Dry Needling for Low Back Pain When Combined With Regular Treatment
- Asthma Research in Children and Adolescents
In development for (5)
- Breast cancer Phase 2
- Breast carcinoma Phase 2
- Colorectal cancer Phase 2
- Neoplasm Phase 3
- Non-small cell lung carcinoma Phase 2