Oleclumab
Highest phase reached
Phase 3
Drug type
Antibody
- Listing at source
- Listed
- Highest phase reached
- Phase 3
- Drug type
- Antibody
- Drug name
- Oleclumab
- durvalumab oleclumab
- immunoglobulin g1 anti human 5 nucleotidase human monoclonal medi9447 heavy chain disulfide with human monoclonal medi9447 lambda chain dimer
- IMMUNOGLOBULIN G1, ANTI-(HUMAN 5'-NUCLEOTIDASE) (HUMAN MONOCLONAL MEDI9447 HEAVY CHAIN), DISULFIDE WITH HUMAN MONOCLONAL MEDI9447 .LAMBDA.-CHAIN, DIMER
- medi 9447
- MEDI-9447
- medi9447
- MEDI9447
- MEDI9447 (oleclumab)
- oleclumab
- Oleclumab
- Oleclumab (MEDI9447)
- oleclumab [INN]
- OLECLUMAB [USAN]
- Oleclumab [WHO-DD]
- oleclumab inn
- oleclumab usan
- oleclumab who dd
- CAS registry numbers
- 1803176-05-7
- ChEMBL ID
- CHEMBL3990016
- FDA ingredient codes (UNII)
- 5CRY01URYQ
- First in class
- No
- Orphan designation
- No
- Pharmacology name
- oleclumab
- Type
- Antibody
- Drug name stem
- -mab
- Action
- Binding
- Action type
- Binding
- Target
- Ecto-5'-Nucleotidase
- Gene symbol
- NT5E
- Protein identifier
- P21589
- Median affinity
- 11.38
- Affinity units
- pKd
- Primary target
- Yes
- Mechanism
- 5'-nucleotidase inhibitor
- Action type
- Inhibitor
- Target
- 5'-nucleotidase
- Protein identifier
- P21589
Open Targets mechanisms
- Mechanism
- 5'-nucleotidase inhibitor
- Action type
- Inhibitor
- Target
- 5'-nucleotidase
- Condition
- Neoplasms
- Highest recorded phase
- 1
- Condition identifier
- EFO:0000616
- Subject identifier
- D009369
- Condition
- Pancreatic Neoplasms
- Highest recorded phase
- 2
- Condition identifier
- EFO:0002618
- Subject identifier
- D010190
- Condition
- Carcinoma, Non-Small-Cell Lung
- Highest recorded phase
- 3
- Condition identifier
- EFO:0003060
- Subject identifier
- D002289
- Condition
- Breast Neoplasms
- Highest recorded phase
- 1
- Condition identifier
- EFO:0003869
- Subject identifier
- D001943
- Condition
- Colorectal Neoplasms
- Highest recorded phase
- 2
- Condition identifier
- EFO:1001951
- Subject identifier
- D015179
- Condition
- Urinary Bladder Neoplasms
- Highest recorded phase
- 1
- Condition identifier
- MONDO:0001187
- Subject identifier
- D001749
- Condition
- Neoplasms
- Highest recorded phase
- 1
- Condition identifier
- MONDO:0004992
- Subject identifier
- D009369
- Condition
- Carcinoma, Pancreatic Ductal
- Highest recorded phase
- 2
- Condition identifier
- MONDO:0005184
- Subject identifier
- D021441
- Condition
- Colorectal Neoplasms
- Highest recorded phase
- 2
- Condition identifier
- MONDO:0005575
- Subject identifier
- D015179
- Condition
- Breast Neoplasms
- Highest recorded phase
- 1
- Condition identifier
- MONDO:0007254
- Subject identifier
- D001943
- Condition
- Prostatic Neoplasms, Castration-Resistant
- Highest recorded phase
- 2
- Condition identifier
- MONDO:0008315
- Subject identifier
- D064129
- Condition identifier
- EFO_0000616
- Highest recorded phase
- 1
- Condition identifier
- EFO_0002618
- Highest recorded phase
- 2
- Condition identifier
- EFO_0003060
- Highest recorded phase
- 3
- Condition identifier
- MONDO_0004986
- Highest recorded phase
- 1
- Condition identifier
- MONDO_0004992
- Highest recorded phase
- 1
- Condition identifier
- MONDO_0005089
- Highest recorded phase
- 2
- Condition identifier
- MONDO_0005184
- Highest recorded phase
- 2
- Condition identifier
- MONDO_0005233
- Highest recorded phase
- 3
- Condition identifier
- MONDO_0005494
- Highest recorded phase
- 1
- Condition identifier
- MONDO_0005549
- Highest recorded phase
- 2
- Condition identifier
- MONDO_0005575
- Highest recorded phase
- 2
- Condition identifier
- MONDO_0006047
- Highest recorded phase
- 2
- Condition identifier
- MONDO_0007254
- Highest recorded phase
- 2
- Condition identifier
- MONDO_0008170
- Highest recorded phase
- 2
- Condition identifier
- MONDO_0008315
- Highest recorded phase
- 2
- Condition identifier
- MONDO_0009807
- Highest recorded phase
- 2
- Condition identifier
- MONDO_0010150
- Highest recorded phase
- 2
- NCT02503774
- NCT04261075
- NCT03334617
- NCT03381274
- NCT03794544
- NCT03801902
- NCT03819465
- NCT03822351
- NCT03833440
- NCT05061550
- NCT05221840
- NCT03616886
- NCT03736473
- NCT03742102
- NCT03773666
- NCT04068610
- NCT04089553
- NCT04145193
- NCT04940286
- NCT06060405
- Prodrug
- No
- Chirality
- Single enantiomer
- Inorganic
- No
- Natural product
- No
- Component
- Heavy chain
- Type
- Protein
- Sequence
- EVQLLESGGGLVQPGGSLRLSCAASGFTFSSYAYSWVRQAPGKGLEWVSAISGSGGRTYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARLGYGRVDEWGRGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPKSCDKTHTCPPCPAPEFEGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPASIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
- Component
- Light chain
- Type
- Protein
- Sequence
- QSVLTQPPSASGTPGQRVTISCSGSLSNIGRNPVNWYQQLPGTAPKLLIYLDNLRLSGVPDRFSGSKSGTSASLAISGLQSEDEADYYCATWDDSHPGWTFGGGTKLTVLGQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPTECS
- Component
- Disulfide bridges location
- Sequence
- 22'-89'$22'''-89'''$22-96$22''-96''$138'-197'$138'''-197'''$144-200$144''-200''$215'-220$215'''-220''$226-226''$ 229-229''$261-321$261''-321''$367-425$367''-425'
Related records
Trials (29)
- A Feasibility Study of Durvalumab +/- Oleclumab as Neoadjuvant Therapy for Muscle-invasive Bladder Cancer (BLASST-2)
- A Global Study to Assess the Effects of Durvalumab With Oleclumab or Durvalumab With Monalizumab Following Concurrent Chemoradiation in Patients With Stage III Unresectable Non-Small Cell Lung Cancer
- A Multi-Cancer, Multi-State, Platform Study of Durvalumab (MEDI4736) and Oleclumab (MEDI9447) in Pancreatic Adenocarcinoma, Non-Small Cell Lung Cancer and Squamous Cell Carcinoma of the Head and Neck to Correlate Clinical, Molecular and Immunologic Parameters With DNA Methylation
- A Phase 1 Clinical Study of AZD4635 in Patients With Advanced Solid Malignancies
- A Phase 2 Study of Durvalumab (MEDI4736) and Oleclumab (MEDI9447) in Multi-Cancer Populations With Correlation to Clinical, Molecular and Immunologic Parameters With DNA MethylaTION
- A Phase I Study of MEDI9447 (Oleclumab) in Japanese Patients
- A Study of Novel Anti-cancer Agents in Patients With Metastatic Triple Negative Breast Cancer
- A Study of Novel Anti-cancer Agents in Patients With Previously Untreated NSCLC
- A Study to Investigate the Effects of Durvalumab With Oleclumab Following Chemoradiation in Participants With Locally Advanced Unresectable Non-Small Cell Lung Cancer (LADOGA)
- An Open-label, Phase II Study of AZD4635 in Patients With Prostate Cancer
- COLUMBIA-1: Novel Oncology Therapies in Combination With Chemotherapy and Bevacizumab as First- Line Therapy in MSS-CRC
- Durvalumab Alone or in Combination With Novel Agents in Subjects With NSCLC
- Durvalumab and Oleclumab in Resectable PDAC
- Gemcitabine, Nab-paclitaxel, Durvalumab, and Oleclumab Before Surgery for the Treatment of in Resectable/Borderline Resectable Primary Pancreatic Cancer
- IPH5201 as Monotherapy or in Combination With Durvalumab +/- Oleclumab in Subjects With Advanced Solid Tumors.
- MEDI9447 Alone and in Combination With MEDI4736 in Adult Participants With Select Advanced Solid Tumors.
- MEDI9447(Oleclumab) Pancreatic Chemotherapy Combination Study.
- Neo-adjuvant Chemotherapy Combined With Stereotactic Body Radiotherapy to the Primary Tumour +/- Durvalumab, +/- Oleclumab in Luminal B Breast Cancer:
- Neoadjuvant and Adjuvant Treatment in Resectable Non-small Cell Lung Cancer
- Neoadjuvant Durvalumab Alone or in Combination With Novel Agents in Resectable Non-Small Cell Lung Cancer
In development for (11)
- Breast cancer Phase 1
- Breast neoplasm Phase 1
- Cancer Phase 1
- Colorectal cancer Phase 2
- Colorectal carcinoma Phase 2
- Exocrine pancreatic carcinoma Phase 2
- Neoplasm Phase 1
- Non-small cell lung carcinoma Phase 3
- Pancreatic ductal adenocarcinoma Phase 2
- Prostate cancer Phase 2
- Urinary bladder cancer Phase 1
Targets (1)
- NT5E 5'-nucleotidase inhibitor