Litifilimab
Highest phase reached
Phase 3
Drug type
Antibody
- Listing at source
- Listed
- Highest phase reached
- Phase 3
- Drug type
- Antibody
- Drug name
- Litifilimab
- 24f4a
- 24F4A
- anti bdca2
- anti-BDCA2
- biib 059
- Biib 059
- BIIB-059
- biib059
- Biib059
- BIIB059
- BIIB059 (litifilimab)
- immunoglobulin g1 anti human blood dendritic cell antigen 2 human mus musculus monoclonal biib059 gamma 1 chain disulfide with human mus musculus monoclonal biib059 kappa chain dimer
- IMMUNOGLOBULIN G1, ANTI-(HUMAN BLOOD DENDRITIC CELL ANTIGEN 2) (HUMAN-MUS MUSCULUS MONOCLONAL BIIB059 .GAMMA.1-CHAIN), DISULFIDE WITH HUMAN-MUS MUSCULUS MONOCLONAL BIIB059 .KAPPA.-CHAIN, DIMER
- litifilimab
- Litifilimab
- litifilimab [INN]
- LITIFILIMAB [USAN]
- Litifilimab [WHO-DD]
- litifilimab inn
- litifilimab usan
- litifilimab who dd
- CAS registry numbers
- 2407378-48-5
- ChEMBL ID
- CHEMBL3833308
- FDA ingredient codes (UNII)
- V27E9V3K7G
- First in class
- No
- Orphan designation
- No
- Pharmacology name
- litifilimab
- Type
- Antibody
- Drug name stem
- -mab
- Action
- Binding
- Action type
- Binding
- Target
- C-type lectin domain family 4 member C
- Gene symbol
- CLEC4C
- Protein identifier
- Q8WTT0
- Mechanism
- C-type lectin domain family 4 member C inhibitor
- Action type
- Inhibitor
- Target
- C-type lectin domain family 4 member C
- Protein identifier
- Q8WTT0
Open Targets mechanisms
- Mechanism
- C-type lectin domain family 4 member C inhibitor
- Action type
- Inhibitor
- Target
- C-type lectin domain family 4 member C
- Condition
- Lupus Erythematosus, Cutaneous
- Highest recorded phase
- 3
- Condition identifier
- EFO:0003834
- Subject identifier
- D008178
- Condition
- Autoimmune Diseases
- Highest recorded phase
- 2
- Condition identifier
- EFO:0005809
- Subject identifier
- D001327
- Condition
- Lupus Erythematosus, Systemic
- Highest recorded phase
- 3
- Condition identifier
- MONDO:0007915
- Subject identifier
- D008180
- Condition identifier
- EFO_0003834
- Highest recorded phase
- 3
- Condition identifier
- EFO_0005809
- Condition identifier
- MONDO_0005282
- Highest recorded phase
- 3
- Condition identifier
- MONDO_0007179
- Condition identifier
- MONDO_0007915
- Highest recorded phase
- 3
- Condition identifier
- MONDO_0015574
- Highest recorded phase
- 2
- NCT02106897
- NCT02847598
- NCT04895241
- NCT04961567
- NCT06044337
- Prodrug
- No
- Chirality
- Single enantiomer
- Inorganic
- No
- Natural product
- No
- Component
- Glycosylation sites (N)
- Sequence
- 302 $ 302''''
- Component
- Heavy chain
- Type
- Protein
- Sequence
- DVQLVESGGGLVKPGGSLRLSCAASGFTFSTYTMSWVRQAPGKGLEWVATISPGDSFGYYYPDSVQGRFTISRDNAKNSLYLQMNSLRAEDTAVYYCTRDIYYNYGAWFAYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPG
- Component
- Light chain
- Type
- Protein
- Sequence
- DIQLTQSPSSLSASVGDRVTITCKASQSVDYDGDSYMNWYQQKPGKAPKLLIYAASTLESGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQANEDPRTFGQGTKVEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC
- Component
- Glycosylation sites (N)
- Sequence
- 302 $ 302''
- Component
- Disulfide bridges
- Sequence
- 22-97 $ 22''-97'' $ 23'-92' $ 23'''-92''' $ 138'-198' $ 138'''-198''' $ 149-205 $ 149''-205'' $ 225-218' $ 225''-218''' $ 231-231'' $ 234-234'' $ 266-326 $ 266''-326'' $ 372-430 $ 372''-430''
Related records
Trials (9)
- A 2-Part Study to Learn Whether Litifilimab (BIIB059) Injections Can Improve Symptoms of Adult Participants Who Have Active Cutaneous Lupus Erythematosus
- A Long-Term Extension Study to Learn More About the Safety of Litifilimab (BIIB059) Injections and Whether They Can Improve Symptoms of Adult Participants Who Have Active Cutaneous Lupus Erythematosus
- A Study to Find Out How Litifilimab is Processed in the Body in Healthy Participants When Given Under the Skin in 3 Different Ways
- A Study to Learn About the Safety of Litifilimab (BIIB059) Injections and Whether They Can Improve Symptoms of Adult Participants Who Have Systemic Lupus Erythematosus
- A Study to Learn About the Safety of Litifilimab (BIIB059) Injections and Whether They Can Improve Symptoms of Adult Participants Who Have Systemic Lupus Erythematosus
- An Extension Study to Learn More About the Long-Term Safety of Litifilimab (BIIB059) Injections and Whether They Can Improve Symptoms of Adult Participants Who Have Systemic Lupus Erythematosus
- Safety, Tolerability, and Pharmacokinetics of Single Doses of BIIB059 in Healthy Japanese Subjects.
- Study Evaluating the Safety, Tolerability, and Pharmacokinetics of Single Doses and Multiple Doses of BIIB059 (Litifilimab) in Healthy Volunteers and Participants With Systemic Lupus Erythematosus
- Study to Evaluate BIIB059 (Litifilimab) in Cutaneous Lupus Erythematosus (CLE) With or Without Systemic Lupus Erythematosus (SLE)
In development for (3)
- Autoimmune disease Phase 2
- Cutaneous lupus erythematosus Phase 3
- Systemic lupus erythematosus Phase 3
Targets (1)
- CLEC4C C-type lectin domain family 4 member C inhibitor