Insulin aspart
Highest phase reached
Approved
Drug type
Protein
First approval year
1999
- First approval year
- 1999
- Listing at source
- Listed
- Highest phase reached
- Approved
- Drug type
- Protein
- Drug name
- Insulin aspart
- fiasp
- Fiasp
- fiasp flextouch
- Fiasp flextouch
- ins novorapid
- Ins novorapid
- insulin aspart component of ryzodeg 70 30
- Insulin aspart component of ryzodeg 70/30
- insulin aspart sanofi
- Insulin aspart sanofi
- Kirsty (previously kixelle)
- kirsty previously kixelle
- novolog
- Novolog
- novorapid
- Novorapid
- 28 sup b l aspartic acid insulin human
- 28(SUP B)-L-ASPARTIC ACID-INSULIN (HUMAN)
- asp
- ASP
- aspart
- Aspart
- ASPART
- aspart insulin
- Aspart insulin
- ASPART INSULIN
- aspart ph20
- aspart- Insulin
- ASPART-PH20
- b 28 asp insulin
- B-28-ASP-INSULIN
- b28 asp insulin
- B28-ASP-INSULIN
- Bedtime insulin Aspart (Novolog)
- Fast-acting Insulin Aspart (Fiasp)
- Faster Insulin Aspart (Fiasp®)
- Fiasp
- Fiasp®
- garzulys
- GARZULYS
- i 004
And 103 more, listed on the interactive page.
- CAS registry numbers
- 116094-23-6
- ChEMBL ID
- CHEMBL1201496
- PubChem compound IDs
- 118984445
- RxNorm IDs (RxCUI)
- 51428
- FDA ingredient codes (UNII)
- D933668QVX
- A10AB05
- A10AD05
Sources for recorded values
- Applicant
- NOVO NORDISK INC
- Approval date
- 7 Jun 2000
- Application number
- BLA020986
- Status
- Authorised
- Status date
- 7 Sept 1999
- Authorisation date
- 7 Sept 1999
- Approved indications
- NovoRapid is indicated for treatment of diabetes mellitus in adults, adolescents and children aged 1 year and above.
- Product number
- EMEA/H/C/000258
- Authorisation holder
- Novo Nordisk A/S
- Priority medicines scheme
- No
- Generic
- No
- Biosimilar
- No
- Generic medicines
- 0
- Biosimilar medicines
- 3
- Advanced therapy
- No
- Conditional approval
- No
- Additional monitoring
- No
- Accelerated assessment
- No
- Exceptional circumstances
- No
Therapeutic areas
- Diabetes Mellitus
European medicines record
- First in class
- No
- Orphan designation
- No
- Availability
- Prescription only
Administration routes
- Parenteral
Mechanisms of action
- Mechanism
- Insulin receptor agonist
- Action type
- Agonist
- Target
- Insulin receptor
- Protein identifier
- P06213
Open Targets mechanisms
- Mechanism
- Insulin receptor agonist
- Action type
- Agonist
- Target
- Insulin receptor
- Condition
- Diabetes Mellitus
- Highest recorded phase
- 4
- Condition identifier
- EFO:0000400
- Subject identifier
- D003920
- Condition
- Hypertension
- Highest recorded phase
- 3
- Condition identifier
- EFO:0000537
- Subject identifier
- D006973
- Condition
- Leukemia
- Highest recorded phase
- 3
- Condition identifier
- EFO:0000565
- Subject identifier
- D007938
- Condition
- Lymphoma
- Highest recorded phase
- 3
- Condition identifier
- EFO:0000574
- Subject identifier
- D008223
- Condition
- Coronary Disease
- Highest recorded phase
- 3
- Condition identifier
- EFO:0001645
- Subject identifier
- D003327
- Condition
- Atherosclerosis
- Highest recorded phase
- 3
- Condition identifier
- EFO:0003914
- Subject identifier
- D050197
- Condition
- Diabetes, Gestational
- Highest recorded phase
- 3
- Condition identifier
- EFO:0004593
- Subject identifier
- D016640
- Condition
- Hypercholesterolemia
- Highest recorded phase
- 3
- Condition identifier
- HP:0003124
- Subject identifier
- D006937
- Condition
- Alzheimer Disease
- Highest recorded phase
- 1
- Condition identifier
- MONDO:0004975
- Subject identifier
- D000544
- Condition
- Diabetes Mellitus, Type 1
- Highest recorded phase
- 3
- Condition identifier
- MONDO:0005147
- Subject identifier
- D003922
- Condition
- Diabetes Mellitus, Type 2
- Highest recorded phase
- 3
- Condition identifier
- MONDO:0005148
- Subject identifier
- D003924
- Condition
- Cystic Fibrosis
- Highest recorded phase
- 3
- Condition identifier
- MONDO:0009061
- Subject identifier
- D003550
- Condition identifier
- EFO_0000400
- Condition identifier
- EFO_0000565
- Highest recorded phase
- 3
- Condition identifier
- EFO_0000574
- Highest recorded phase
- 3
- Condition identifier
- EFO_0801077
- Highest recorded phase
- 3
- Condition identifier
- HP_0001268
- Highest recorded phase
- 2
- Condition identifier
- HP_0001394
- Highest recorded phase
- 3
- Condition identifier
- HP_0001943
- Highest recorded phase
- 2
- Condition identifier
- HP_0003074
- Condition identifier
- HP_0040270
- Condition identifier
- MONDO_0000873
- Highest recorded phase
- 3
- Condition identifier
- MONDO_0004967
- Highest recorded phase
- 3
- Condition identifier
- MONDO_0004975
- Condition identifier
- MONDO_0004975
- Highest recorded phase
- 1
- Condition identifier
- MONDO_0005015
- Highest recorded phase
- 4
- Condition identifier
- MONDO_0005147
- Highest recorded phase
- 3
- Condition identifier
- MONDO_0005148
- Highest recorded phase
- 3
- Condition identifier
- MONDO_0005240
- Condition identifier
- MONDO_0005406
- Highest recorded phase
- 3
- Condition identifier
- MONDO_0007243
- Highest recorded phase
- 3
- Condition identifier
- MONDO_0009061
- Highest recorded phase
- 3
- Condition identifier
- MONDO_0012819
- Condition identifier
- MONDO_1060198
- Highest recorded phase
- 1
- Event
- anti-insulin antibody positive
- Reports
- 57
- Reporting signal score
- 236.263
- Event
- blood glucose abnormal
- Reports
- 255
- Reporting signal score
- 638.527
- Event
- blood glucose decreased
- Reports
- 618
- Reporting signal score
- 1,670.08
- Event
- blood glucose fluctuation
- Reports
- 193
- Reporting signal score
- 529.957
- Event
- blood glucose increased
- Reports
- 2,359
- Reporting signal score
- 6,415.09
- Event
- diabetes mellitus inadequate control
- Reports
- 397
- Reporting signal score
- 979.961
- Event
- diabetic ketoacidosis
- Reports
- 756
- Reporting signal score
- 1,764.43
- Event
- diabetic metabolic decompensation
- Reports
- 71
- Reporting signal score
- 202.448
- Event
- diabetic neuropathy
- Reports
- 94
- Reporting signal score
- 232.763
- Event
- diabetic retinopathy
- Reports
- 146
- Reporting signal score
- 461.482
- Event
- glycosylated haemoglobin increased
- Reports
- 351
- Reporting signal score
- 805.2
- Event
- hyper ige syndrome
- Reports
- 24
- Reporting signal score
- 126.265
- Event
- hyperglycaemia
- Reports
- 564
- Reporting signal score
- 1,071.3
- Event
- hypoglycaemia
- Reports
- 2,582
- Reporting signal score
- 7,926.12
- Event
- hypoglycaemia neonatal
- Reports
- 118
- Reporting signal score
- 361.453
- Event
- hypoglycaemia unawareness
- Reports
- 47
- Reporting signal score
- 196.209
- Event
- hypoglycaemic coma
- Reports
- 304
- Reporting signal score
- 1,047.68
- Event
- hypoglycaemic seizure
- Reports
- 82
- Reporting signal score
- 293.075
- Event
- hypoglycaemic unconsciousness
- Reports
- 182
- Reporting signal score
- 724.12
- Event
- insulin resistance
- Reports
- 64
- Reporting signal score
- 197.712
- Event
- ketoacidosis
- Reports
- 155
- Reporting signal score
- 336.471
- Event
- liquid product physical issue
- Reports
- 29
- Reporting signal score
- 79.184
- Event
- loss of consciousness
- Reports
- 416
- Reporting signal score
- 262.409
- Event
- polycystic ovaries
- Reports
- 24
- Reporting signal score
- 77.6412
- Event
- premature baby
- Reports
- 410
- Reporting signal score
- 642.263
And 4 more, listed on the interactive page.
- NCT00000620
- NCT00082407
- NCT00097084
- NCT00097279
- NCT00097877
- NCT00106366
- NCT00115973
- NCT00184574
- NCT00184600
- NCT00184613
- NCT00267683
- NCT00280046
- NCT00313001
- NCT00318786
- NCT00331604
- NCT00434954
- NCT00476437
- NCT00504673
- NCT00564668
- NCT00598793
- NCT00600626
- NCT00605020
- NCT00612599
- NCT00613951
- NCT00614055
And 214 more, listed on the interactive page.
- Route
- Subcutaneous
- How often
- Twice daily
- Administer within 15 minutes before meal
- Do not inject intravenously or use in insulin infusion pumps
- Inject in abdominal, buttocks, thigh, or upper arm
- Prodrug
- No
- Chirality
- Single enantiomer
- Inorganic
- No
- Natural product
- No
- Component
- Sequence
- Type
- Protein
- Sequence
- FVNQHLCGSHLVEALYLVCGERGFFYTDKT
- Component
- Light chain
- Type
- Protein
- Sequence
- GIVEQCCTSICSLYQLENYCN
- 0024-5927
- 0024-5928
- 0169-2001
- 0169-2100
- 0169-2101
- 0169-2200
- 0169-2201
- 0169-3201
- 0169-3204
- 0169-3205
- 0169-3206
- 0169-3303
- 0169-3685
- 0169-3696
- 0169-6338
- 0169-6339
- 0169-7501
- 71288-903
- 71288-904
- 71288-909
- 73070-100
- 73070-102
- 73070-103
- 73070-200
- 73070-203
And 13 more, listed on the interactive page.
Related records
Trials (361)
- A 26-week Trial Comparing Efficacy and Safety of Insulin Degludec/Insulin Aspart BID and Insulin Degludec OD Plus Insulin Aspart in Subjects With Type 2 Diabetes Mellitus Treated With Basal Insulin in Need of Treatment Intensification With Mealtime Insulin
- A 38 Week Trial Comparing Effect and Safety of Insulin Degludec/Insulin Aspart vs. Insulin Glargine Plus Insulin Aspart in Subjects With Type 2 Diabetes Treated With Basal Insulin With or Without Oral Antidiabetic Treatment in Need of Treatment Intensification
- A Clinical Trial Comparing Efficacy and Safety of Insulin Degludec/Liraglutide (IDegLira) Versus Basal-bolus Therapy in Subjects With Type 2 Diabetes Mellitus
- A Comparison Between Two Formulations of NN5401 in Healthy Subjects
- A Comparison of Pharmacodynamics and Pharmacokinetics of Insulin Aspart, BIAsp70, BIAsp50 and Fast-acting Human Insulin
- A Comparison of Pharmacodynamics and Pharmacokinetics of Insulin Aspart, Biphasic Insulin Aspart 30, 50 and 70.
- A Fully-closed Loop, Pramlintide and Insulin, Artificial Pancreas Clinical Trial for Adults With Type 1 Diabetes
- A Meal Test Study of LY900014 in Participants With Type 1 Diabetes Mellitus
- A Pan Asian Trial Comparing Efficacy and Safety of NN5401 and Biphasic Insulin Aspart 30 in Type 2 Diabetes
- A Pharmacokinetic and Glucodynamic Study of Subcutaneously Administered Insulin Analogs With rHuPH20 Compared to Insulin Analogs Alone
- A Phase III Study of Insulin Aspart Injection to Evaluate the Efficacy and Safety
- A Randomised Proof-of-Principle Trial Investigating Pharmacodynamics, Pharmacokinetics, and Safety of NNC0143-0406 in Subjects With Type 1 Diabetes Mellitus
- A Randomised Trial Comparing Efficacy and Safety After Intensification With Either Insulin Aspart Once Daily as add-on or Changing to Basal Bolus Treatment With Insulin Degludec and Insulin Aspart in Subjects With Type 2 Diabetes Previously Treated With Insulin Degludec/Insulin Aspart Twice Daily
- A Randomised Trial Evaluating Continuous Subcutaneous Infusion of Formulations of NN1218 and NovoLog® in Subjects With Type 1 Diabetes
- A Randomised Trial Investigating the Pharmacokinetic and Pharmacodynamic Properties of Faster-acting Insulin Aspart in Subjects With Type 1 Diabetes
- A Regulatory Post Marketing Surveillance (rPMS) Study of Ryzodeg® FlexTouch® (Insulin Degludec /Insulin Aspart) to Evaluate Safety and Effectiveness in Patients With Diabetes Mellitus in Routine Clinical Practice in Korea
- A Research Study Looking at How Faster Aspart Injected in Double Concentration Works in the Body of People With Type 1 Diabetes Mellitus
- A Research Study Looking at How the Use of NovoPen® 6 for Treatment With Tresiba® & Fiasp® Affects the Blood Sugar Level in Patients With Type 1 Diabetes as Part of Local Clinical Practice
- A Research Study of How Faster-acting Insulin Aspart Moves Into, Through, and Out of the Body and How it Works in the Body When Given Through an Insulin Pump to People With Type 1 Diabetes
- A Research Study to Compare a New Weekly Insulin, Insulin Icodec, and an Available Daily Insulin, Insulin Degludec, Both in Combination With Mealtime Insulin in People With Type 1 Diabetes (ONWARDS 6)
Approved for (1)
In development for (10)
- Alzheimer disease Phase 1
- Atherosclerosis Phase 3
- Coronary artery disorder Phase 3
- Cystic fibrosis Phase 3
- Gestational diabetes Phase 3
- Hypertensive disorder Phase 3
- Leukemia Phase 3
- Lymphoma Phase 3
- Type 1 diabetes mellitus Phase 3
- Type 2 diabetes mellitus Phase 3
Targets (1)
- INSR Insulin receptor agonist