Frexalimab
Highest phase reached
Phase 3
Drug type
Antibody
- Listing at source
- Listed
- Highest phase reached
- Phase 3
- Drug type
- Antibody
- Drug name
- Frexalimab
- frexalimab
- Frexalimab
- frexalimab [INN]
- FREXALIMAB [USAN]
- Frexalimab [WHO-DD]
- frexalimab inn
- frexalimab usan
- frexalimab who dd
- Immunoglobulin G1 (272-arginine,325-alanine), anti-(human CD40 ligand) (human-mus musculus monoclonal SAR441344 gamma1-chain), disulfide with human-mus musculus monoclonal SAR441344 kappa-chain, dimer
- immunoglobulin g1 272 arginine 325 alanine anti human cd40 ligand human mus musculus monoclonal sar441344 gamma1 chain disulfide with human mus musculus monoclonal sar441344 kappa chain dimer
- inx 021
- INX 021
- inx 021 56
- INX 021-56
- inx021
- INX021
- inx021 56
- INX021-56
- sar 441344
- SAR-441344
- sar441344
- Sar441344
- SAR441344
- SAR441344 IV
- xc 01129
And 3 more, listed on the interactive page.
- CAS registry numbers
- 2515463-86-0
- ChEMBL ID
- CHEMBL5095122
- FDA ingredient codes (UNII)
- WO7SFK0ENJ
- First in class
- No
- Orphan designation
- No
- Drug name stem
- -mab
- Condition
- Nervous System Diseases
- Highest recorded phase
- 1
- Condition identifier
- EFO:0000618
- Subject identifier
- D009422
- Condition
- Sjogren's Syndrome
- Highest recorded phase
- 2
- Condition identifier
- EFO:0000699
- Subject identifier
- D012859
- Condition
- Autoimmune Diseases
- Highest recorded phase
- 1
- Condition identifier
- EFO:0005809
- Subject identifier
- D001327
- Condition
- Diabetes Mellitus, Type 1
- Highest recorded phase
- 2
- Condition identifier
- MONDO:0005147
- Subject identifier
- D003922
- Condition
- Multiple Sclerosis
- Highest recorded phase
- 3
- Condition identifier
- MONDO:0005301
- Subject identifier
- D009103
- Condition identifier
- EFO_0000618
- Condition identifier
- EFO_0000699
- Highest recorded phase
- 2
- Condition identifier
- EFO_0005809
- Condition identifier
- MONDO_0000450
- Highest recorded phase
- 3
- Condition identifier
- MONDO_0005071
- Condition identifier
- MONDO_0005147
- Highest recorded phase
- 2
- Condition identifier
- MONDO_0005301
- Highest recorded phase
- 3
- Condition identifier
- MONDO_0006835
- Highest recorded phase
- 2
- Condition identifier
- MONDO_0007179
- Condition identifier
- MONDO_0007915
- Highest recorded phase
- 2
- Condition identifier
- MONDO_0010030
- Highest recorded phase
- 2
- Condition identifier
- MONDO_0100313
- Highest recorded phase
- 2
- NCT04572841
- NCT04879628
- NCT06141473
- NCT06141486
- NCT06111586
- Prodrug
- No
- Chirality
- Single enantiomer
- Inorganic
- No
- Natural product
- No
- Component
- Heavy chain
- Type
- Protein
- Sequence
- EVQLQESGPGLVKPSETLSLTCTVSGDSITNGFWIWIRKPPGNKLEYMGYISYSGSTYYNPSLKSRISISRDTSKNQFSLKLSSVTAADTGVYYCAYRSYGRTPYYFDYWGQGTTLTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKAEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHRDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCAVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
- Component
- Light chain
- Type
- Protein
- Sequence
- DIVMTQSPSFLSASVGDRVTITCKASSNLGHAVAWYQQKPGKSPKLLIYSASNRYTGVPDRFSGSGSGTDFTLTISSLQPEDFADYFCQQYDDYPYTFGGGTKLEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC
- Component
- Glycosylation sites (N)
- Sequence
- 300 $ 300'
- Component
- Disulfide bridges
- Sequence
- 22-95 $ 22''-95'' $ 23'-88' $ 23'''-88''' $ 134'-194' $ 134'''-194''' $ 147-203 $ 147''-203'' $ 223-214' $ 223''-214''' $ 229-229'' $ 232-232'' $ 264-324 $ 264''-324'' $ 370-428 $ 370''-428''
- Component
- Glycosylation sites (N)
- Sequence
- 300 $ 300''
Related records
Trials (10)
- A Study to Evaluate the Efficacy and Safety of Frexalimab, Brivekimig, or Rilzabrutinib in Participants Aged 16 to 75 Years With Primary Focal Segmental Glomerulosclerosis or Minimal Change Disease
- A Study to Investigate the Efficacy and Safety of Frexalimab Versus Tacrolimus in Adults Undergoing Kidney Transplantation
- Efficacy and Safety of Frexalimab (SAR441344) in the Treatment of Systemic Lupus Erythematosus
- Efficacy and Safety Studies of Frexalimab (SAR441344) in Adults With Relapsing Forms of Multiple Sclerosis
- Efficacy and Safety Study of Frexalimab (SAR441344) in Adults With Nonrelapsing Secondary Progressive Multiple Sclerosis
- Frexalimab in Preservation of Endogenous Insulin Secretion Compared to Placebo in Adults, Adolescents and Children on Top of Insulin Therapy (FABULINUS)
- Non-inferiority Study of Frexalimab Subcutaneous Administration Compared to Intravenous Administration in Adult Participants With Multiple Sclerosis
- Proof-of-concept Study for SAR441344 (Frexalimab) in Relapsing Multiple Sclerosis
- Safety, Tolerability, Pharmacokinetics, and Therapeutic Efficacy of SAR441344 in Primary Sjögren's Syndrome (pSjS)
- Study of Safety, Tolerability, Pharmacokinetics, and Pharmacodynamics of Intravenous and Subcutaneous Single and Repeated Doses of SAR441344 in Healthy Adult Subjects
In development for (6)
- Autoimmune disease Phase 1
- Multiple sclerosis Phase 3
- Nervous system disorder Phase 1
- Sjogren syndrome Phase 2
- Systemic lupus erythematosus Phase 2
- Type 1 diabetes mellitus Phase 2