Duvakitug
Highest phase reached
Phase 2
Drug type
Antibody
- Listing at source
- Listed
- Highest phase reached
- Phase 2
- Drug type
- Antibody
- Drug name
- Duvakitug
- duvakitug
- Duvakitug
- duvakitug [INN]
- DUVAKITUG [USAN]
- duvakitug inn
- duvakitug usan
- gamma1 heavy chain Homo sapiens (1-448) [VH (Homo sapiens IGHV1-8*01 (92.9%) -(IGHD) -IGHJ4*01 (92.9%),CDR-IMGT [8.8.12] (26-33.51-58.97-108)) (1-119)-Homo sapiens IGHG1*01 (100%), G1m17,1 CH1 K120, CH3 D12,L14 (CH1 K120 (216) (120-217), hinge 1-15 (218-232), CH2(233-342), CH3 D12 (358), L14 (360) (343-447), CHS K2>del(448)) (120-448)], (222-215')-disulfide with lambda light chain Homo sapiens(1'-216') [V-LAMBDA (Homo sapiens IGLV1-40*01 (85.7%) -IGLJ2*01 (90.9%), CDR-IMGT [9.3.10] (26-34.52-54.91-100)) (1'-110') -Homo sapiens IGLC2*01 (100%)(111'-216')]; dimer (228-228'':231-231'')-bisdisulfide, produced in Chinese hamster ovary (CHO) cells, cell line CHO-K1SV, glycoform alfa
- gamma1 heavy chain homo sapiens 1 448 vh homo sapiens ighv1 8 01 92 9 ighd ighj4 01 92 9 cdr imgt 8 8 12 26 33 51 58 97 108 1 119 homo sapiens ighg1 01 100 g1m17 1 ch1 k120 ch3 d12 l14 ch1 k120 216 120 217 hinge 1 15 218 232 ch2 233 342 ch3 d12 358 l14 360 343 447 chs k2 del 448 120 448 222 215 disulfide with lambda light chain homo sapiens 1 216 v lambda homo sapiens iglv1 40 01 85 7 iglj2 01 90 9 cdr imgt 9 3 10 26 34 52 54 91 100 1 110 homo sapiens iglc2 01 100 111 216 dimer 228 228 231 231 bisdisulfide produced in chinese hamster ovary cho cells cell line cho k1sv glycoform alfa
- Immunoglobulin G1 [de-449-lysine], anti-(human tumor necrosis factor superfamily protein TNFSF15) (human monoclonal TEV-48574 γ1-chain), disulfide with human monoclonal TEV-48574 λ-chain, dimer
- immunoglobulin g1 de 449 lysine anti human tumor necrosis factor superfamily protein tnfsf15 human monoclonal tev 48574 γ1 chain disulfide with human monoclonal tev 48574 λ chain dimer
- tev 48574
- Tev-48574
- TEV-48574
- CAS registry numbers
- 2750005-84-4
- ChEMBL ID
- CHEMBL5314733
- FDA ingredient codes (UNII)
- B2I7YTE4ZA
- First in class
- No
- Orphan designation
- No
- Pharmacology name
- duvakitug
- Type
- Antibody
Mechanisms of action
- Action
- Binding
- Action type
- Binding
- Target
- TL1A
- Gene symbol
- TL1A
- Median affinity
- 10.39
- Affinity units
- pKd
- Condition
- Crohn Disease
- Highest recorded phase
- 1
- Condition identifier
- EFO:0000384
- Subject identifier
- D003424
- Condition
- Colitis, Ulcerative
- Highest recorded phase
- 1
- Condition identifier
- EFO:0000729
- Subject identifier
- D003093
- Condition
- Asthma
- Highest recorded phase
- 2
- Condition identifier
- MONDO:0004979
- Subject identifier
- D001249
- Condition
- Inflammation
- Highest recorded phase
- 2
- Condition identifier
- MP:0001845
- Subject identifier
- D007249
- Condition identifier
- EFO_0000384
- Highest recorded phase
- 3
- Condition identifier
- EFO_0000729
- Highest recorded phase
- 3
- Condition identifier
- MONDO_0004979
- Highest recorded phase
- 2
- Condition identifier
- MONDO_0005011
- Highest recorded phase
- 3
- Condition identifier
- MONDO_0005101
- Highest recorded phase
- 3
- Condition identifier
- MP_0001845
Trial references
- NCT04545385
- Prodrug
- No
- Chirality
- Single enantiomer
- Inorganic
- No
- Natural product
- No
- Component
- Heavy chain
- Type
- Protein
- Sequence
- QVQLVQSGAEVKKPGASVKVSCKASGYTFTSYDINWVRQAPGQGLEWMGWLNPNSGYTGYAQKFQGRVTMTADRSTSTAYMELSSLRSEDTAVYYCAREVPETAAFEYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPG
- Component
- Disulfide bridges
- Sequence
- 22-96 $ 22''-96'' $ 22'-90' $ 22'''-90''' $ 138'-197' $ 138'''-197''' $ 146-202 $ 146''-202'' $ 222-215' $ 222''-215''' $ 228-228'' $ 231-231'' $ 263-323 $ 263''-323'' $ 369-427 $ 369''-427''
- Component
- Light chain
- Type
- Protein
- Sequence
- QSVLTQPPSVSGAPGQRVTISCTSSSSDIGAGLGVHWYQQLPGTAPKLLIEGYYNRPSGVPDRFSGSKSGTSASLTITGLLPEDEGDYYCQSWDGTLSALFGGGTKLTVLGQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPTECS
- Component
- Glycosylation sites (N)
- Sequence
- 299 $ 299''
Related records
Trials (7)
- A Maintenance Study to Investigate the Efficacy and Safety of Duvakitug in Participants With Moderately to Severely Active Crohn's Disease
- A Maintenance Study to Investigate the Efficacy and Safety of Duvakitug in Participants With Moderately to Severely Active Ulcerative Colitis
- A Study to Evaluate the Long-Term Effect of TEV-48574 in Moderate to Severe Ulcerative Colitis or Crohn's Disease
- A Study to Test if TEV-48574 is Effective in Relieving Asthma
- A Study to Test the Effect of TEV-48574 in Moderate to Severe Ulcerative Colitis or Crohn's Disease
- An Induction Study to Investigate the Efficacy and Safety of Duvakitug in Participants With Moderately to Severely Active Crohn's Disease
- An Induction Study to Investigate the Efficacy and Safety of Duvakitug in Participants With Moderately to Severely Active Ulcerative Colitis
In development for (3)
- Asthma Phase 2
- Crohn disease Phase 1
- Ulcerative colitis Phase 1