Budigalimab
Highest phase reached
Phase 2
Drug type
Antibody
- Listing at source
- Listed
- Highest phase reached
- Phase 2
- Drug type
- Antibody
- Drug name
- Budigalimab
- abbv 181
- Abbv-181
- ABBV-181
- abbv181
- ABBV181
- anti pd1 monoclonal antibody abbv 181
- ANTI-PD1 MONOCLONAL ANTIBODY ABBV-181
- budigalimab
- Budigalimab
- budigalimab [INN]
- BUDIGALIMAB [USAN]
- Budigalimab [WHO-DD]
- budigalimab inn
- budigalimab usan
- budigalimab who dd
- immunoglobulin g1 anti human programmed cell death protein 1 human mus musculus monoclonal pr 1648817 gamma 1 chain disulfide with human mus musculus monoclonal pr 1648817 kappa chain dimer
- IMMUNOGLOBULIN G1, ANTI-(HUMAN PROGRAMMED CELL DEATH PROTEIN 1), (HUMAN-MUS MUSCULUS MONOCLONAL PR-1648817 .GAMMA.1-CHAIN), DISULFIDE WITH HUMAN-MUS MUSCULUS MONOCLONAL PR-1648817 .KAPPA.-CHAIN, DIMER
- pr 1648817
- PR-1648817
- CAS registry numbers
- 2098225-93-3
- ChEMBL ID
- CHEMBL4297858
- FDA ingredient codes (UNII)
- 6VDO4TY3OO
- First in class
- No
- Orphan designation
- No
- Drug name stem
- -mab
Mechanisms of action
- Mechanism
- Programmed cell death protein 1 inhibitor
- Action type
- Inhibitor
- Target
- Programmed cell death protein 1
- Protein identifier
- Q15116
Open Targets mechanisms
- Mechanism
- Programmed cell death protein 1 inhibitor
- Action type
- Inhibitor
- Target
- Programmed cell death protein 1
- Condition
- HIV Infections
- Highest recorded phase
- 1
- Condition identifier
- EFO:0000180
- Subject identifier
- D015658
- Condition
- Carcinoma, Hepatocellular
- Highest recorded phase
- 2
- Condition identifier
- EFO:0000182
- Subject identifier
- D006528
- Condition
- Neoplasms
- Highest recorded phase
- 1
- Condition identifier
- EFO:0000616
- Subject identifier
- D009369
- Condition
- Small Cell Lung Carcinoma
- Highest recorded phase
- 1
- Condition identifier
- EFO:0000702
- Subject identifier
- D055752
- Condition
- Melanoma
- Highest recorded phase
- 1
- Condition identifier
- EFO:0000756
- Subject identifier
- D008545
- Condition
- HIV Infections
- Highest recorded phase
- 1
- Condition identifier
- EFO:0000764
- Subject identifier
- D015658
- Condition
- Carcinoma, Non-Small-Cell Lung
- Highest recorded phase
- 2
- Condition identifier
- EFO:0003060
- Subject identifier
- D002289
- Condition
- Head and Neck Neoplasms
- Highest recorded phase
- 1
- Condition identifier
- EFO:0006859
- Subject identifier
- D006258
- Condition
- Neoplasms
- Highest recorded phase
- 1
- Condition identifier
- MONDO:0004992
- Subject identifier
- D009369
- Condition
- Colorectal Neoplasms
- Highest recorded phase
- 1
- Condition identifier
- MONDO:0005575
- Subject identifier
- D015179
- Condition
- Breast Neoplasms
- Highest recorded phase
- 1
- Condition identifier
- MONDO:0007254
- Subject identifier
- D001943
- Condition
- Ovarian Neoplasms
- Highest recorded phase
- 1
- Condition identifier
- MONDO:0008170
- Subject identifier
- D010051
- Condition identifier
- EFO_0000616
- Highest recorded phase
- 1
- Condition identifier
- EFO_0000702
- Highest recorded phase
- 1
- Condition identifier
- EFO_0000756
- Condition identifier
- EFO_0000764
- Highest recorded phase
- 2
- Condition identifier
- EFO_0003060
- Condition identifier
- EFO_0006859
- Highest recorded phase
- 1
- Condition identifier
- MONDO_0002158
- Highest recorded phase
- 1
- Condition identifier
- MONDO_0003219
- Highest recorded phase
- 2
- Condition identifier
- MONDO_0004992
- Highest recorded phase
- 1
- Condition identifier
- MONDO_0005028
- Highest recorded phase
- 2
- Condition identifier
- MONDO_0005036
- Highest recorded phase
- 2
- Condition identifier
- MONDO_0005070
- Highest recorded phase
- 1
- Condition identifier
- MONDO_0005086
- Highest recorded phase
- 1
- Condition identifier
- MONDO_0005105
- Condition identifier
- MONDO_0005140
- Highest recorded phase
- 1
- Condition identifier
- MONDO_0005233
- Highest recorded phase
- 2
- Condition identifier
- MONDO_0005494
- Highest recorded phase
- 1
- Condition identifier
- MONDO_0005575
- Highest recorded phase
- 1
- Condition identifier
- MONDO_0005627
- Highest recorded phase
- 1
- Condition identifier
- MONDO_0006047
- Highest recorded phase
- 2
- Condition identifier
- MONDO_0007256
- Highest recorded phase
- 2
- Condition identifier
- MONDO_0008170
- Highest recorded phase
- 1
- Condition identifier
- MONDO_0008433
- Highest recorded phase
- 1
- Condition identifier
- MONDO_0010150
- Highest recorded phase
- 1
- Condition identifier
- MONDO_0011962
- Highest recorded phase
- 1
And 4 more, listed on the interactive page.
- Event
- abdominal pain
- Reports
- 4
- Reporting signal score
- 11.4603
- Event
- anaemia
- Reports
- 4
- Reporting signal score
- 11.3801
- Event
- clostridium difficile infection
- Reports
- 2
- Reporting signal score
- 8.90078
- Event
- decreased appetite
- Reports
- 3
- Reporting signal score
- 8.49579
- Event
- dehydration
- Reports
- 4
- Reporting signal score
- 13.5943
- Event
- fatigue
- Reports
- 4
- Reporting signal score
- 7.77245
- Event
- immune-mediated hepatitis
- Reports
- 2
- Reporting signal score
- 14.2521
- Event
- large intestinal obstruction
- Reports
- 2
- Reporting signal score
- 13.6956
- NCT01946074
- NCT03000257
- NCT05599984
- NCT06158958
- NCT02539719
- NCT02988960
- NCT03071757
- NCT03138408
- NCT03821935
- NCT04196283
- NCT03035279
- NCT03639194
- NCT03818542
- NCT03893955
- NCT04223804
- NCT04799353
- NCT05822752
- NCT06109272
- NCT06236438
- Prodrug
- No
- Chirality
- Single enantiomer
- Inorganic
- No
- Natural product
- No
- Component
- Heavy chain
- Type
- Protein
- Sequence
- EIQLVQSGAEVKKPGSSVKVSCKASGYTFTHYGMNWVRQAPGQGLEWVGWVNTYTGEPTYADDFKGRLTFTLDTSTSTAYMELSSLRSEDTAVYYCTREGEGLGFGDWGQGTTVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPEAAGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
- Component
- Light chain
- Type
- Protein
- Sequence
- DVVMTQSPLSLPVTPGEPASISCRSSQSIVHSHGDTYLEWYLQKPGQSPQLLIYKVSNRFSGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCFQGSHIPVTFGQGTKLEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC
- Component
- Glycosylation sites (N)
- Sequence
- Asn-298 $ Asn-298''''
- Component
- Disulfide bridges
- Sequence
- 22-96 $ 22''-96'' $ 23'-93' $ 23'''-93''' $ 139'-199' $ 139'''-199''' $ 145-201 $ 145''-201'' $ 219'-221 $ 219'''-221'' $ 227-227'' $ 230-230'' $ 262-322 $ 262''-322'' $ 368-426 $ 368''-426''
- Component
- Glycosylation sites (N)
- Sequence
- Asn-298 $ Asn-298''
Related records
Trials (27)
- A Study of ABBV-011 Alone and in Combination With Budigalimab (ABBV-181) in Participants With Relapsed or Refractory Small Cell Lung Cancer
- A Study of ABBV-927 and ABBV-181, an Immunotherapy, in Participants With Advanced Solid Tumors
- A Study of ABT-165 in Subjects With Solid Tumors
- A Study of Budigalimab (ABBV-181) in Participants With Advanced Solid Tumors
- A Study of SC-006 and in Combination With ABBV-181 in Subjects With Advanced Colorectal Cancer
- A Study of the Safety, Tolerability and Pharmacokinetics of ABBV-368 as a Single Agent and Combination in Subjects With Locally Advanced or Metastatic Solid Tumors
- A Study to Assess Change in Disease Activity, Adverse Events, and How the Drug Moves Through the Body in Adult Participants Living With Human Immunodeficiency Virus (HIV) Receiving Intravenous (IV) Infusion or Subcutaneous (SC) Injection of Budigalimab and/or ABBV-382
- A Study to Assess the Adverse Events and How Intravenously Infused Livmoniplimab in Combination With Budigalimab Moves Through the Bodies of Adult Chinese Participants With Locally Advanced or Metastatic Hepatocellular Carcinoma (HCC)
- A Study to Assess the Adverse Events, Change in Disease Activity, and How Oral ABBV-711 Tablets Move Through the Body as a Monotherapy and in Combination With Intravenously Infused Budigalimab (ABBV-181), in Adults With Advanced Squamous Tumors
- A Study to Assess the Dose, Adverse Events, and Change in Disease Activity of Livmoniplimab as an Intravenous (IV) Solution in Combination With Budigalimab as an IV Solution in Adult Participants With Hepatocellular Carcinoma (HCC)
- A Study to Assess the Effects of Multiple Study Drug Regimens in Subjects With Newly Diagnosed Locally Advanced Head and Neck Squamous Cell Carcinoma
- A Study to Assess the Safety, Pharmacokinetics, and Efficacy of Intravenous (IV) ABBV-303, as Monotherapy and in Combination With IV Infused Budigalimab (ABBV-181), in Adults With Advanced Solid Tumors
- A Study to Determine the Safety, Tolerability, Pharmacokinetics, and Preliminary Efficacy of ABBV-368 Plus Tilsotolimod and Other Therapy Combinations in Participants With Recurrent/Metastatic Head and Neck Squamous Cell Carcinoma
- A Study to Determine the Safety, Tolerability, Pharmacokinetics, and Preliminary Efficacy of ABBV-927 With ABBV-368, Budigalimab (ABBV-181) and/or Chemotherapy in Participants With Locally Advanced or Metastatic Solid Tumors
- A Study to Evaluate the Adverse Events, Efficacy, and Optimal Dose of Intravenous (IV) ABBV-400 in Combination With IV Fluorouracil, Leucovorin, and Budigalimab in Adult Participants With Locally Advanced Unresectable or Metastatic Gastric, Gastroesophageal Junction, or Esophageal Adenocarcinoma
- A Study to Evaluate the Safety, Pharmacokinetics and Pharmacodynamics of ABBV-181 (Budigalimab) in Adult Participants With Human Immunodeficiency Virus (HIV)-1
- Phase 2 Study of TTX-030 and Chemotherapy With or Without Budigalimab for 1L mPDAC Patients
- SC-004 Alone or With ABBV-181 in Subjects With Epithelial Ovarian, Fallopian Tube, Primary Peritoneal and Endometrial Cancers
- Study to Assess Adverse Events and Pharmacokinetics in Adult Participants With Non-Small Cell Lung Cancer, Head and Neck Squamous Cell Carcinoma and Other Solid Tumors, Receiving Intravenous Infusion of Azirkitug Alone or in Combination(s) With Budigalimab, Bevacizumab, or Telisotuzumab Adizutecan
- Study to Determine the Safety, Tolerability, Pharmacokinetics and Recommended Phase 2 Dose (RP2D) of Livmoniplimab (ABBV-151) as a Single Agent and in Combination With Budigalimab (ABBV-181) in Participants With Locally Advanced or Metastatic Solid Tumors
In development for (11)
- Breast cancer Phase 1
- Cancer Phase 1
- Colorectal cancer Phase 1
- Head and neck cancer Phase 1
- Hepatocellular carcinoma Phase 2
- HIV infectious disease Phase 1
- Melanoma Phase 1
- Neoplasm Phase 1
- Non-small cell lung carcinoma Phase 2
- Ovarian cancer Phase 1
- Small cell lung carcinoma Phase 1
Targets (1)
- PDCD1 Programmed cell death protein 1 inhibitor