Bimagrumab
Highest phase reached
Phase 3
Drug type
Antibody
- Listing at source
- Listed
- Highest phase reached
- Phase 3
- Drug type
- Antibody
- Drug name
- Bimagrumab
- bimagrumab
- Bimagrumab
- bimagrumab [INN]
- BIMAGRUMAB [JAN]
- BIMAGRUMAB [USAN]
- Bimagrumab [WHO-DD]
- bimagrumab inn
- bimagrumab jan
- bimagrumab usan
- bimagrumab who dd
- bym 338
- BYM-338
- bym338
- BYM338
- human anti actriib monoclonal antibody
- HUMAN ANTI-ACTRIIB MONOCLONAL ANTIBODY
- immunoglobulin g1 lambda2 anti homo sapiens acvr2b activin a receptor type iib actr iib homo sapiens monoclonal antibody
- IMMUNOGLOBULIN G1-LAMBDA2, ANTI-(HOMO SAPIENS ACVR2B (ACTIVIN A RECEPTOR TYPE IIB, ACTR-IIB)), HOMO SAPIENS MONOCLONAL ANTIBODY
- o81t794r34
- O81t794r34
- CAS registry numbers
- 1356922-05-8
- ChEMBL ID
- CHEMBL3137353
- FDA ingredient codes (UNII)
- N15SW1DIV8
- Patents
- 0
- Designations
- 2
- First in class
- No
- Fast track
- No
- Breakthrough designation
- Yes
- Orphan designation
- No
- Priority review
- No
- Orphan exclusivity
- No
- Accelerated approval
- No
- Pharmacology name
- bimagrumab
- Type
- Antibody
- Drug name stem
- -mab
- Mechanism
- Activin receptor type-2B antagonist
- Action type
- Antagonist
- Target
- Activin receptor type-2B
- Protein identifier
- Q13705
- Action
- Binding
- Action type
- Binding
- Target
- activin A receptor type 2A
- Gene symbol
- ACVR2A
- Protein identifier
- P27037
- Median affinity
- 9.36
- Affinity units
- pKd
- Action
- Binding
- Action type
- Binding
- Target
- activin A receptor type 2B
- Gene symbol
- ACVR2B
- Protein identifier
- Q13705
- Median affinity
- 11.76
- Affinity units
- pKd
- Primary target
- Yes
Open Targets mechanisms
- Mechanism
- Activin receptor type-2B antagonist
- Action type
- Antagonist
- Target
- Activin receptor type-2B
- Condition
- Pulmonary Disease, Chronic Obstructive
- Highest recorded phase
- 2
- Condition identifier
- EFO:0000341
- Subject identifier
- D029424
- Condition
- Myositis, Inclusion Body
- Highest recorded phase
- 3
- Condition identifier
- EFO:0007323
- Subject identifier
- D018979
- Condition
- Muscular Atrophy
- Highest recorded phase
- 2
- Condition identifier
- EFO:0009851
- Subject identifier
- D009133
- Condition
- Sarcopenia
- Highest recorded phase
- 2
- Condition identifier
- EFO:1000653
- Subject identifier
- D055948
- Condition
- Cachexia
- Highest recorded phase
- 2
- Condition identifier
- HP:0004326
- Subject identifier
- D002100
- Condition
- Diabetes Mellitus, Type 2
- Highest recorded phase
- 2
- Condition identifier
- MONDO:0005148
- Subject identifier
- D003924
- Condition identifier
- EFO_0000341
- Highest recorded phase
- 2
- Condition identifier
- EFO_0007323
- Highest recorded phase
- 3
- Condition identifier
- EFO_0009851
- Highest recorded phase
- 2
- Condition identifier
- EFO_1000653
- Highest recorded phase
- 2
- Condition identifier
- HP_0001513
- Highest recorded phase
- 2
- Condition identifier
- HP_0004326
- Highest recorded phase
- 2
- Condition identifier
- HP_0025502
- Highest recorded phase
- 2
- Condition identifier
- MONDO_0005002
- Highest recorded phase
- 2
- Condition identifier
- MONDO_0005148
- Highest recorded phase
- 2
- Condition identifier
- MONDO_0007827
- Highest recorded phase
- 3
- Condition identifier
- MONDO_0011122
- Highest recorded phase
- 2
- Condition identifier
- MONDO_0015667
- Condition identifier
- MONDO_0015667
- Highest recorded phase
- 2
- NCT01423110
- NCT01925209
- NCT02250443
- NCT02573467
- NCT01433263
- NCT01601600
- NCT02333331
- NCT02468674
- NCT01669174
- NCT02152761
- NCT03005288
- Prodrug
- No
- Chirality
- Single enantiomer
- Inorganic
- No
- Natural product
- No
- Component
- Heavy chain
- Type
- Protein
- Organism
- Homo sapiens
- Sequence
- QVQLVQSGAEVKKPGASVKVSCKASGYTFTSSYINWVRQAPGQGLEWMGTINPVSGSTSYAQKFQGRVTMTRDTSISTAYMELSRLRSDDTAVYYCARGGWFDYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPKSCDKTHTCPPCPAPEAAGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPG
- Component
- Light chain
- Type
- Protein
- Organism
- Homo sapiens
- Sequence
- QSALTQPASVSGSPGQSITISCTGTSSDVGSYNYVNWYQQHPGKAPKLMIYGVSKRPSGVSNRFSGSKSGNTASLTISGLQAEDEADYYCGTFAGGSYYGVFGGGTKLTVLGQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPTECS
Related records
Trials (17)
- A 24-week Off-drug Extension Study in Sarcopenic Elderly Who Completed Treatment in the 6-month Core Study
- A Multi-center Study to Assess the Effects of BYM338 on Skeletal Muscle in Sarcopenic Adults
- A Study of Bimagrumab (LY3985863) and Tirzepatide (LY3298176), Alone or in Combination, in Participants With Obesity or Overweight With Type 2 Diabetes
- A Study of Bimagrumab Alone (LY3985863) and Bimagrumab With Tirzepatide (LY900042) in Healthy Participants
- A Study to Investigate Weight Management With Bimagrumab (LY3985863) and Tirzepatide (LY3298176), Alone or in Combination, in Adults With Obesity or Overweight
- An Extension Study of the Efficacy, Safety and Tolerability of BYM338 (Bimagrumab) in Patients With Sporadic Inclusion Body Myositis Who Previously Participated in the Core Study CBYM338B2203
- BYM338 in Chronic Obstructive Pulmonary Disease (COPD) Patients With Cachexia
- Clinical Study of BYM338 for the Treatment of Unintentional Weight Loss in Patients With Cancer of the Lung or the Pancreas
- Dose Range Finding Study of Bimagrumab in Sarcopenia
- Effect of Tirzepatide and Bimagrumab on Body Composition, Insulin Sensitivity, and Bone in Adults With Obesity
- Efficacy and Safety of Bimagrumab/BYM338 at 52 Weeks on Physical Function, Muscle Strength, Mobility in sIBM Patients
- Efficacy, Safety and Tolerability of BYM338 in Patients With Sporadic Inclusion Body Myositis
- Safety and Efficacy of Bimagrumab and Semaglutide in Adults Who Are Overweight or Obese
- Safety, Pharmacokinetics and Efficacy of Bimagrumab in Overweight and Obese Patients With Type 2 Diabetes
- Study of Efficacy and Safety of Bimagrumab in Patients After Hip Fracture Surgery
- Study of Long-term Safety, Efficacy Tolerability of BYM338 in Patients With Sporadic Inclusion Body Myositis
- Study of Muscle Effects of BYM338 in Mechanically Ventilated Patients
In development for (4)
- Chronic obstructive pulmonary disease Phase 2
- Inclusion body myositis Phase 3
- Muscular atrophy Phase 2
- Type 2 diabetes mellitus Phase 2
Other linked conditions (1)
- Acute myeloid leukemia by FAB classification
Targets (1)
- ACVR2B Activin receptor type-2B antagonist