Benmelstobart
Highest phase reached
Phase 3
Drug type
Antibody
- Listing at source
- Listed
- Highest phase reached
- Phase 3
- Drug type
- Antibody
- Drug name
- Benmelstobart
- apl 502
- APL-502
- apl502
- APL502
- benmelstobart
- Benmelstobart
- benmelstobart [INN]
- Benmelstobart [WHO-DD]
- benmelstobart Injection
- benmelstobart inn
- benmelstobart who dd
- cbt 502
- CBT-502
- cbt502
- CBT502
- gamma1 heavy chain humanized (1-446) [VH (Homo sapiens IGHV2-5*01 (78.6%) -(IGHD) -IGHJ4*01 (100%), CDR-IMGT [8.7.10] (26-33.51-57.96-105)) (1-116)-Homo sapiens IGHG1*01, G1m17,1 CH1 K120, CH3 D12, L14, G1v66 CH2 A27 (CH1 K120(213) (117-214), hinge 1-15 (215-229), CH2 D27>A (264) (230-339), CH3 D12 (355),L14 (357) (340-444), CHS (445-446)) (117-446)], (219-214')-disulfide with kappa light chain humanized (1'-214') [V-KAPPA (Homo sapiens IGKV1-33*01 (82.1%) -IGKJ2*01 (100%), CDR-IMGT [6.3.9] (27-32.50-52.89-97)) (1'-107') -Homo sapiens IGKC*01 (100%), Km3, A45.1 (153), V101 (191) (108'-214')]; dimer (225-225'':228-228'')-bisdisulfide
- gamma1 heavy chain humanized 1 446 vh homo sapiens ighv2 5 01 78 6 ighd ighj4 01 100 cdr imgt 8 7 10 26 33 51 57 96 105 1 116 homo sapiens ighg1 01 g1m17 1 ch1 k120 ch3 d12 l14 g1v66 ch2 a27 ch1 k120 213 117 214 hinge 1 15 215 229 ch2 d27 a 264 230 339 ch3 d12 355 l14 357 340 444 chs 445 446 117 446 219 214 disulfide with kappa light chain humanized 1 214 v kappa homo sapiens igkv1 33 01 82 1 igkj2 01 100 cdr imgt 6 3 9 27 32 50 52 89 97 1 107 homo sapiens igkc 01 100 km3 a45 1 153 v101 191 108 214 dimer 225 225 228 228 bisdisulfide
- Immunoglobulin G1 [264-alanine], anti-(human programmed death-ligand 1) (human-Mus musculus monoclonal CBT-502 γ1-chain), disulfide with human-Mus musculus monoclonal CBT-502 κ-chain, dimer
- immunoglobulin g1 264 alanine anti human programmed death ligand 1 human mus musculus monoclonal cbt 502 γ1 chain disulfide with human mus musculus monoclonal cbt 502 κ chain dimer
- tqb 2450
- TQB-2450
- tqb2450
- Tqb2450
- TQB2450
- TQB2450 injection
And 2 more, listed on the interactive page.
- CAS registry numbers
- 2303884-58-2
- ChEMBL ID
- CHEMBL5315042
- FDA ingredient codes (UNII)
- B25CF42QKP
- First in class
- No
- Orphan designation
- No
- Pharmacology name
- benmelstobart
- Type
- Antibody
- Drug name stem
- -bart
- Approval recorded by Guide to Pharmacology
- Yes
Mechanisms of action
- Action
- Binding
- Action type
- Binding
- Target
- programmed cell death 1 ligand 1
- Gene symbol
- programmed cell death 1 ligand 1
- Primary target
- Yes
- Condition
- Lymphoma, Follicular
- Highest recorded phase
- 2
- Condition identifier
- EFO:0000096
- Subject identifier
- D008224
- Condition
- Carcinoma, Squamous Cell
- Highest recorded phase
- 3
- Condition identifier
- EFO:0000181
- Subject identifier
- D002294
- Condition
- Carcinoma, Hepatocellular
- Highest recorded phase
- 3
- Condition identifier
- EFO:0000182
- Subject identifier
- D006528
- Condition
- Neoplasms
- Highest recorded phase
- 3
- Condition identifier
- EFO:0000616
- Subject identifier
- D009369
- Condition
- Small Cell Lung Carcinoma
- Highest recorded phase
- 3
- Condition identifier
- EFO:0000702
- Subject identifier
- D055752
- Condition
- Esophageal Neoplasms
- Highest recorded phase
- 2
- Condition identifier
- EFO:0002916
- Subject identifier
- D004938
- Condition
- Carcinoma, Non-Small-Cell Lung
- Highest recorded phase
- 3
- Condition identifier
- EFO:0003060
- Subject identifier
- D002289
- Condition
- Cholangiocarcinoma
- Highest recorded phase
- 1
- Condition identifier
- EFO:0005221
- Subject identifier
- D018281
- Condition
- Esophageal Neoplasms
- Highest recorded phase
- 2
- Condition identifier
- EFO:0005922
- Subject identifier
- D004938
- Condition
- Kidney Neoplasms
- Highest recorded phase
- 3
- Condition identifier
- MONDO:0002367
- Subject identifier
- D007680
- Condition
- Uterine Cervical Neoplasms
- Highest recorded phase
- 2
- Condition identifier
- MONDO:0002974
- Subject identifier
- D002583
- Condition
- Biliary Tract Neoplasms
- Highest recorded phase
- 2
- Condition identifier
- MONDO:0003060
- Subject identifier
- D001661
- Condition
- Neoplasms
- Highest recorded phase
- 3
- Condition identifier
- MONDO:0004992
- Subject identifier
- D009369
- Condition
- Breast Neoplasms
- Highest recorded phase
- 1
- Condition identifier
- MONDO:0007254
- Subject identifier
- D001943
- Condition
- Ovarian Neoplasms
- Highest recorded phase
- 3
- Condition identifier
- MONDO:0008170
- Subject identifier
- D010051
- Condition
- Lung Neoplasms
- Highest recorded phase
- 1
- Condition identifier
- MONDO:0008903
- Subject identifier
- D008175
- Condition
- Endometrial Neoplasms
- Highest recorded phase
- 3
- Condition identifier
- MONDO:0011962
- Subject identifier
- D016889
- Condition
- Nasopharyngeal Carcinoma
- Highest recorded phase
- 2
- Condition identifier
- MONDO:0015459
- Subject identifier
- D000077274
- Condition identifier
- EFO_0000096
- Highest recorded phase
- 2
- Condition identifier
- EFO_0000181
- Highest recorded phase
- 3
- Condition identifier
- EFO_0000182
- Highest recorded phase
- 2
- Condition identifier
- EFO_0000616
- Condition identifier
- EFO_0000702
- Highest recorded phase
- 3
- Condition identifier
- EFO_0002916
- Highest recorded phase
- 2
- Condition identifier
- EFO_0003060
- Highest recorded phase
- 3
- Condition identifier
- EFO_0003891
- Highest recorded phase
- 2
- Condition identifier
- EFO_0005221
- Condition identifier
- EFO_0005922
- Highest recorded phase
- 2
- Condition identifier
- MONDO_0000448
- Highest recorded phase
- 2
- Condition identifier
- MONDO_0001056
- Highest recorded phase
- 2
- Condition identifier
- MONDO_0002108
- Highest recorded phase
- 2
- Condition identifier
- MONDO_0002158
- Highest recorded phase
- 2
- Condition identifier
- MONDO_0002974
- Highest recorded phase
- 2
- Condition identifier
- MONDO_0003060
- Highest recorded phase
- 2
- Condition identifier
- MONDO_0003219
- Highest recorded phase
- 2
- Condition identifier
- MONDO_0003960
- Highest recorded phase
- 2
- Condition identifier
- MONDO_0004958
- Highest recorded phase
- 2
- Condition identifier
- MONDO_0004992
- Condition identifier
- MONDO_0004992
- Highest recorded phase
- 2
- Condition identifier
- MONDO_0005005
- Highest recorded phase
- 3
- Condition identifier
- MONDO_0005036
- Highest recorded phase
- 1
- Condition identifier
- MONDO_0005070
- Highest recorded phase
- 1
- Condition identifier
- MONDO_0005086
- Highest recorded phase
- 3
And 25 more, listed on the interactive page.
- NCT03460457
- NCT03897283
- NCT05645315
- NCT06116240
- NCT03855358
- NCT03855384
- NCT03910127
- NCT04306926
- NCT04325763
- NCT04964479
- NCT05346952
- NCT05718167
- NCT05913089
- NCT05922345
- NCT06141226
- NCT03983928
- NCT03996408
- NCT04002622
- NCT04234607
- NCT04539977
- NCT04236362
- NCT04809142
- NCT04523272
- NCT04574284
- NCT06475599
And 9 more, listed on the interactive page.
- Prodrug
- No
- Chirality
- Single enantiomer
- Inorganic
- No
- Natural product
- No
- Component
- Heavy chain
- Type
- Protein
- Sequence
- QITLKESGPTLVKPTQTLTLTCTVSGFSLSTYGVHWIRQPPGKALEWLGVIWRGVTTDYNAAFMSRLTITKDNSKNQVVLTMNNMDPVDTATYYCARLGFYAMDYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVAVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
- Component
- Disulfide bridges
- Sequence
- 22-95 $ 22''-95'' $ 23'-88' $ 23'''-88''' $ 134'-194' $ 134'''-194''' $ 143-199 $ 143''-199'' $ 219-214' $ 219''-214''' $ 225-225'' $ 228-228'' $ 260-320 $ 260''-320'' $ 366-424 $ 366''-424''
- Component
- Light chain
- Type
- Protein
- Sequence
- DIQMTQSPSSLSASVGDRVTITCKASQSVSNDVAWYQQKPGKAPKLLIYYAANRYTGVPDRFSGSGYGTDFTFTISSLQPEDIATYFCQQDYTSPYTFGQGTKLEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC
- Component
- Glycosylation sites (N)
- Sequence
- 296 $ 296''
Related records
Trials (96)
- A Clinical Study of TQB2450 Combined With Anlotinib in Limited-Stage Small Cell Lung Cancer Patients
- A Clinical Study of TQB2450 Injection Combined With Anlotinib Hydrochloride Capsules Versus K Drug in the Treatment of First-line Non-small Cell Lung Cancer(NSCLC)
- A Clinical Study of TQB2450 Injection Combined With Anlotinib Hydrochloride Capsules Versus Paclitaxel as Weekly Treatment of Relapsed Platinum-resistant Ovarian Cancer
- A Clinical Study of TQB2450 Injection Combined With Chemotherapy or Anlotinib Hydrochloride Capsule in the Treatment of Non Small Cell Lung Cancer
- A Clinical Trial Evaluating TQB2102 for Injection in Combination With Behmosubaisumab/Payamprolizumab With or Without Chemotherapy in Unresectable Locally Advanced, Recurrent, or Metastatic Human Epidermal Growth Factor Receptor 2 (HER2)-Positive Gastroesophageal Adenocarcinoma
- A Clinical Trial of TQB2450 Injection Combined With AL2846 Capsules in Patients With Advanced Solid Tumors
- A Phase Ib Study of TQB2450 Combined With Anlotinib in Patients With Limited Stage Small Cell Lung Cancer After First-line Radiotherapy and Chemotherapy
- A Phase II Study of Benmelstobart + Anlotinib + Chemotherapy as First-Line Treatment for LCNEC and EP-NEC
- A Phase II Study to Evaluate the Safety and Efficacy of TQB2450 Injection in Relapsed or Refractory Classical Hodgkin's Lymphoma
- A Phase Ⅱ/Ⅲ Study of HRS-2129 for Postsurgical Pain Management in Abdominal Surgery
- A Single-arm, Exploratory Clinical Study Evaluating the Efficacy and Safety of Bevacizumab in Combination With Anlotinib and Etoposide as First-line Therapy for Elderly Patients With Small-cell Lung Cancer or Those Who Are Intolerant to Intensive Chemotherapy
- A Single-arm, Multicenter Exploratory Clinical Trial of Anlotinib Combined With TQB2450 and the SOX Regimen as First-line Treatment for Advanced Gastric Cancer With Low PD-L1 Expression
- A Study of Benmelstobart, Anlotinib, Chemotherapy and Thoracic Radiotherapy for People With Extensive-stage Small Cell Lung Cancer
- A Study of TQB2450 Combined With Anlotinib in Subjects With Gynecological Cancer
- A Study of TQB2450 in Combination With Intensity-modulated Radiotherapy in Patients With Inoperable Locally Recurrent Nasopharyngeal Carcinoma
- A Study of TQB2450 in Subjects With Stage III Non-Small Cell Lung Cancer(NSCLC)
- A Study of TQB2450 Injection and Anlotinib Hydrochloride Capsules to Treat Triple Negative Breast Cancer (TNBC)
- A Study of TQB2450 Injection Combined With Anlotinib Hydrochloride Capsule as Second-line Treatment in Subjects With Advanced Biliary Cancer
- A Study of TQB2450 Injection Combined With Anlotinib Hydrochloride Capsule in Subjects With Advanced Endometrial Cancer
- A Study of TQB2450 Injection Combined With Anlotinib Hydrochloride Capsule Versus Paclitaxel for Injection (Albumin Bound) in Subjects With Triple Negative Breast Cancer (TNBC)
In development for (21)
- Biliary tract cancer Phase 2
- Biliary tract neoplasm Phase 2
- Breast cancer Phase 1
- Cancer Phase 3
- Carcinoma of esophagus Phase 2
- Cervical cancer Phase 2
- Cholangiocarcinoma Phase 1
- Endometrial cancer Phase 3
- Esophageal squamous cell carcinoma Phase 2
- Head and neck squamous cell carcinoma Phase 3
- Hepatocellular carcinoma Phase 3
- Kidney cancer Phase 3
- Lung cancer Phase 1
- Nasopharyngeal carcinoma Phase 2
- Neoplasm Phase 3
- Neoplasm of mature B-cells Phase 2
- Non-small cell lung carcinoma Phase 3
- Ovarian cancer Phase 3
- Pheochromocytoma Phase 2
- Small cell lung carcinoma Phase 3