Atacicept
Highest phase reached
Phase 3
Drug type
Protein
- Listing at source
- Listed
- Highest phase reached
- Phase 3
- Drug type
- Protein
- Drug name
- Atacicept
- atacicept
- Atacicept
- atacicept [INN]
- ATACICEPT [MI]
- ATACICEPT [USAN]
- Atacicept [WHO-DD]
- Atacicept 150 mg
- Atacicept 25 mg
- Atacicept 75 mg
- atacicept inn
- atacicept mi
- atacicept usan
- atacicept vymj
- atacicept who dd
- Atacicept-VYMJ
- fus mabfrag human igg1 fc rprotfrag o14836 tr13b human 30110
- FUS: MABFRAG HUMAN (IGG1 FC); RPROTFRAG O14836 (TR13B_HUMAN) (30110)
- HUMAN TRANSMEMBRANE ACTIVATOR AND CAML INTERACTOR (TACI) -IMMUNOGLOBULIN G SUB(1) FC DOMAIN FUSION PROTEIN (FC5)
- human transmembrane activator and caml interactor taci immunoglobulin g sub 1 fc domain fusion protein fc5
- taci fc5
- taci ig
- TACI-FC5
- TACI-IG
- trutakna
- TRUTAKNA
- CAS registry numbers
- 845264-92-8
- ChEMBL ID
- CHEMBL1742986
- RxNorm IDs (RxCUI)
- 2747209
- FDA ingredient codes (UNII)
- K3D9A0ICQ3
- Patents
- 0
- Designations
- 1
- First in class
- No
- Fast track
- No
- Breakthrough designation
- Yes
- Orphan designation
- No
- Priority review
- No
- Orphan exclusivity
- No
- Accelerated approval
- No
- Pharmacology name
- atacicept
- Type
- Peptide
- Drug name stem
- -cept
- Mechanism
- Tumor necrosis factor ligand superfamily member 13 inhibitor
- Action type
- Inhibitor
- Target
- Tumor necrosis factor ligand superfamily member 13
- Protein identifier
- O75888
- Mechanism
- Tumor necrosis factor ligand superfamily member 13B inhibitor
- Action type
- Inhibitor
- Target
- Tumor necrosis factor ligand superfamily member 13B
- Protein identifier
- Q9Y275
- Mechanism
- Tumor necrosis factor ligand superfamily member 13 inhibitor
- Action type
- Inhibitor
- Target
- Tumor necrosis factor ligand superfamily member 13
- Mechanism
- Tumor necrosis factor ligand superfamily member 13B inhibitor
- Action type
- Inhibitor
- Target
- Tumor necrosis factor ligand superfamily member 13B
- Condition
- Arthritis, Rheumatoid
- Highest recorded phase
- 2
- Condition identifier
- EFO:0000685
- Subject identifier
- D001172
- Condition
- Glomerulonephritis, IGA
- Highest recorded phase
- 3
- Condition identifier
- EFO:0004194
- Subject identifier
- D005922
- Condition
- Lupus Nephritis
- Highest recorded phase
- 3
- Condition identifier
- EFO:0005761
- Subject identifier
- D008181
- Condition
- Optic Neuritis
- Highest recorded phase
- 2
- Condition identifier
- EFO:0007405
- Subject identifier
- D009902
- Condition
- Multiple Sclerosis
- Highest recorded phase
- 2
- Condition identifier
- MONDO:0005301
- Subject identifier
- D009103
- Condition
- Lupus Erythematosus, Systemic
- Highest recorded phase
- 2
- Condition identifier
- MONDO:0007915
- Subject identifier
- D008180
- Condition identifier
- EFO_0000574
- Highest recorded phase
- 3
- Condition identifier
- EFO_0000685
- Highest recorded phase
- 2
- Condition identifier
- EFO_0004194
- Highest recorded phase
- 3
- Condition identifier
- EFO_0005761
- Highest recorded phase
- 3
- Condition identifier
- EFO_0007405
- Highest recorded phase
- 2
- Condition identifier
- MONDO_0004670
- Highest recorded phase
- 2
- Condition identifier
- MONDO_0005062
- Highest recorded phase
- 3
- Condition identifier
- MONDO_0005301
- Highest recorded phase
- 2
- Condition identifier
- MONDO_0005342
- Highest recorded phase
- 3
- Condition identifier
- MONDO_0005556
- Highest recorded phase
- 3
- Condition identifier
- MONDO_0005885
- Highest recorded phase
- 2
- Condition identifier
- MONDO_0006835
- Highest recorded phase
- 2
- Condition identifier
- MONDO_0007915
- Condition identifier
- MONDO_0007915
- Highest recorded phase
- 2
- Condition identifier
- MONDO_0008383
- Highest recorded phase
- 2
- Condition identifier
- MONDO_0100313
- Highest recorded phase
- 2
Reported adverse events
- Event
- blood immunoglobulin g decreased
- Reports
- 3
- Reporting signal score
- 24.8817
- NCT00430495
- NCT00595413
- NCT00664521
- NCT00573157
- NCT01369628
- NCT05609812
- NCT00624338
- NCT01440231
- NCT01972568
- NCT02070978
- NCT00624468
- NCT00642902
- NCT00853762
- NCT02808429
- NCT04716231
- Prodrug
- No
- Chirality
- Single enantiomer
- Inorganic
- No
- Natural product
- No
Sequences
- Component
- Sequence
- Type
- Protein
- Sequence
- AMRSCPEEQYWDPLLGTCMSCKTICNHQSQRTCAAFCRSLSCRKEQGKFYDHLLRDCISCASICGQHPKQCAYFCENKLRSEPKSSDKTHTCPPCPAPEAEGAPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPSSIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
- 85052-101
Related records
Trials (19)
- A Phase 2 Dose-finding Study of Atacicept in Subjects With Rheumatoid Arthritis (AUGUST I)
- A Phase 2 Study of Atacicept in Subjects With Relapsing Multiple Sclerosis (ATAMS)
- A Rollover Study to Evaluate the Long-Term Safety and Efficacy of Atacicept
- Atacicept Demonstrating Dose RESponSe
- Atacicept in Anti-Tumor Necrosis Factor Alpha-naïve Subjects With Rheumatoid Arthritis (AUGUST II)
- Atacicept in Combination With Rituximab in Subjects With Rheumatoid Arthritis (August III)
- Atacicept in Lupus Nephritis Patients Taking Stable Regimen of Mycophenolate Mofetil
- Atacicept in Multiple Glomerular Diseases
- Atacicept in Multiple Sclerosis Extension Study, Phase II
- Atacicept in Subjects With Active Lupus Nephritis (COMPASS)
- Atacicept in Subjects With IgA Nephropathy
- Atacicept in Subjects With Optic Neuritis
- Atacicept Phase 2/3 in Generalized Systemic Lupus Erythematosus (APRIL-SLE)
- CD24Fc for the Treatment of Immune Related Adverse Events in Patients With Advanced Solid Tumors, TIRAEC Study
- Efficacy and Safety of Atacicept in IgA Nephropathy
- Efficacy and Safety of Atacicept in Systemic Lupus Erythematosus
- Long-term Safety and Tolerability of Atacicept (Long-term Follow-Up of Participant Who Participated in ADDRESS II)
- Monthly Dosing of Atacicept in IgAN
- The Efficacy and Safety of Atacicept in Combination With Mycophenolate Mofetil Used to Treat Lupus Nephritis
In development for (8)
- IgA glomerulonephritis Phase 3
- Lupus erythematosus Phase 2
- Lupus nephritis Phase 3
- Lymphoma Phase 3
- Multiple sclerosis Phase 2
- Optic neuritis Phase 2
- Rheumatoid arthritis Phase 2
- Systemic lupus erythematosus Phase 2