Vixarelimab
Highest phase reached
Phase 2
Drug type
Antibody
- Listing at source
- Listed
- Highest phase reached
- Phase 2
- Drug type
- Antibody
- Drug name
- Vixarelimab
- 30C6 (N73D) IGG4P.AGLY/IGG1
- 30C6 [N73D) IgG4P.agly/IgG1
- 30c6 n73d igg4p agly igg1
- biib 069
- BIIB-069
- biib069
- BIIB069
- IMMUNOGLOBULIN G (234-PROLINE,303-GLUTAMINE), ANTI-(HUMAN ONCOSTATIN M RECEPTOR SUBUNIT .BETA.) (HUMAN MONOCLONAL KPL-716 .GAMMA.-CHAIN), DISULFIDE WITH HUMAN MONOCLONAL KPL-716 .LAMBDA.-CHAIN, DIMER
- immunoglobulin g 234 proline 303 glutamine anti human oncostatin m receptor subunit beta human monoclonal kpl 716 gamma chain disulfide with human monoclonal kpl 716 lambda chain dimer
- kpl 716
- Kpl-716
- KPL-716
- vixarelimab
- Vixarelimab
- vixarelimab [INN]
- VIXARELIMAB [USAN]
- Vixarelimab [WHO-DD]
- vixarelimab inn
- vixarelimab usan
- vixarelimab who dd
- CAS registry numbers
- 2243320-83-2
- ChEMBL ID
- CHEMBL4594341
- FDA ingredient codes (UNII)
- W25GO3A75W
- Patents
- 0
- Designations
- 1
- First in class
- No
- Fast track
- No
- Breakthrough designation
- Yes
- Orphan designation
- No
- Priority review
- No
- Orphan exclusivity
- No
- Accelerated approval
- No
- Pharmacology name
- vixarelimab
- Type
- Antibody
- Drug name stem
- -mab
- Action
- Binding
- Action type
- Binding
- Target
- Oncostatin M-specific receptor, β subunit
- Gene symbol
- OSMR
- Protein identifier
- Q99650
- Mechanism
- Oncostatin-M-specific receptor subunit beta inhibitor
- Action type
- Inhibitor
- Target
- Oncostatin-M-specific receptor subunit beta
- Protein identifier
- Q99650
Open Targets mechanisms
- Mechanism
- Oncostatin-M-specific receptor subunit beta inhibitor
- Action type
- Inhibitor
- Target
- Oncostatin-M-specific receptor subunit beta
- Condition
- Colitis, Ulcerative
- Highest recorded phase
- 2
- Condition identifier
- EFO:0000729
- Subject identifier
- D003093
- Condition
- Pruritus
- Highest recorded phase
- 1
- Condition identifier
- HP:0000989
- Subject identifier
- D011537
- Condition identifier
- EFO_0000274
- Highest recorded phase
- 1
- Condition identifier
- EFO_0000729
- Highest recorded phase
- 2
- Condition identifier
- EFO_0000768
- Highest recorded phase
- 2
- Condition identifier
- EFO_1001494
- Highest recorded phase
- 2
- Condition identifier
- HP_0000989
- Highest recorded phase
- 1
- Condition identifier
- HP_0000989
- Highest recorded phase
- 2
- Condition identifier
- MONDO_0004980
- Highest recorded phase
- 1
- Condition identifier
- MONDO_0005101
- Highest recorded phase
- 2
- Condition identifier
- MONDO_0006572
- Highest recorded phase
- 2
- Condition identifier
- MONDO_0006585
- Highest recorded phase
- 2
- Condition identifier
- MONDO_0015925
- Highest recorded phase
- 2
- Condition identifier
- MONDO_0026045
- Highest recorded phase
- 2
- Condition identifier
- MONDO_0044212
- Highest recorded phase
- 2
Trial references
- NCT06137183
- Prodrug
- No
- Chirality
- Single enantiomer
- Inorganic
- No
- Natural product
- No
- Component
- Heavy chain
- Type
- Protein
- Sequence
- QVQLVQSGAEVKKPGASVKVSCKASGYTFTSYEINWVRQATGQGLEWMGWMNPNSGYTGYAQKFQGRVTMTRDTSISTAYMEMSSLRSEDTAVYYCARDIVAANTDYYFYYGMDVWGQGTTVTVSSASTKGPSVFPLAPCSRSTSESTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTKTYTCNVDHKPSNTKVDKRVESKYGPPCPPCPAPEFLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSQEDPEVQFNWYVDGVEVHNAKTKPREEQFQSTYRVVSVLTVLHQDWLNGKEYKCKVSNKGLPSSIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPG
- Component
- Light chain
- Type
- Protein
- Sequence
- QSVLTQPPSASGTPGQRVTISCSGSNSNIGSNTVNWYHQLPGTAPKLLIYNINKRPSGVPDRFSGSKSGSSASLAISGLQSEDEADYYCSTWDDSLDGVVFGGGTKLTVLGQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPTECS
- Component
- Disulfide bridges
- Sequence
- 22'-89' $ 22'''-89''' $ 22-96 $ 22''-96'' $ 138'-197' $ 138'''-197''' $ 140-215'' $ 140''-215''' $ 153-209 $ 153''-209'' $ 232-232'' $ 235-235'' $ 267-327 $ 267''-327'' $ 373-431 $ 373''-431''
Related records
Trials (5)
- A Study Evaluating the Efficacy and Safety of Vixarelimab in Participants With Idiopathic Pulmonary Fibrosis and in Participants With Systemic Sclerosis-Associated Interstitial Lung Disease
- A Study to Assess the Efficacy, Safety, and Tolerability of KPL-716 in Reducing Pruritus in Chronic Pruritic Diseases
- A Study to Evaluate the Activity, and Safety of Vixarelimab in Participants With Moderate to Severe Active Ulcerative Colitis
- A Study to Evaluate the Efficacy, Safety, and Pharmacokinetics of Vixarelimab in Participants With Moderate to Severe Ulcerative Colitis (UC)
- Study to Assess the Efficacy, Safety, and Tolerability of Vixarelimab in Reducing Pruritus in Prurigo Nodularis
In development for (2)
- Atopic eczema Phase 1
- Ulcerative colitis Phase 2
Targets (1)
- OSMR Oncostatin-M-specific receptor subunit beta inhibitor