Verekitug
Highest phase reached
Phase 2
Drug type
Antibody
- Listing at source
- Listed
- Highest phase reached
- Phase 2
- Drug type
- Antibody
- Drug name
- Verekitug
- asp 7266
- ASP-7266
- asp7266
- ASP7266
- ASP7266 (HUMAN MONOCLONAL IGG1 AGAINST THYMIC STROMAL LYMPHOPOIETIN RECEPTOR (TSLPR))
- asp7266 human monoclonal igg1 against thymic stromal lymphopoietin receptor tslpr
- immunoglobulin g1 anti human and macaca fascicularis cytokine receptor like factor 2 human monoclonal upb 101 γ1 chain disulfide with human monoclonal upb 101 κ chain dimer
- immunoglobulin g1 kappa anti homo sapiens crlf2 cytokine receptor like factor 2 tslpr thymic stromal lymphopoietin receptor homo sapiens monoclonal antibody
- Immunoglobulin G1-kappa, anti-[Homo sapiens CRLF2 (cytokine receptor like factor 2, TSLPR, thymic stromal lymphopoietin receptor)], Homo sapiens monoclonal antibody
- Immunoglobulin G1, anti-(human and Macaca fascicularis cytokine receptor-like factor 2) (human monoclonal UPB-101 γ1-chain), disulfide with human monoclonal UPB-101 κ-chain, dimer
- trab 1
- TRAB-1
- upb 101
- Upb-101
- UPB-101
- verekitug
- Verekitug
- Verekitug (UPB-101)
- verekitug [INN]
- VEREKITUG [USAN]
- verekitug inn
- verekitug usan
- CAS registry numbers
- 2768386-15-6
- ChEMBL ID
- CHEMBL5315002
- FDA ingredient codes (UNII)
- T1NAO7YDA7
- First in class
- No
- Orphan designation
- No
- Condition
- Asthma
- Highest recorded phase
- 1
- Condition identifier
- MONDO:0004979
- Subject identifier
- D001249
- Condition
- Inflammation
- Highest recorded phase
- 2
- Condition identifier
- MP:0001845
- Subject identifier
- D007249
- Condition identifier
- EFO_0000341
- Highest recorded phase
- 2
- Condition identifier
- EFO_1002029
- Highest recorded phase
- 2
- Condition identifier
- MONDO_0004979
- Highest recorded phase
- 2
- Condition identifier
- MONDO_0005002
- Highest recorded phase
- 2
- Condition identifier
- MP_0001845
Trial references
- NCT05448651
- Prodrug
- No
- Chirality
- Single enantiomer
- Inorganic
- No
- Natural product
- No
- Component
- Heavy chain
- Type
- Protein
- Sequence
- EVQLLESGGGLVQPGGSLRLSCAASGFTFRSSAMHWVRQAPGKGLKWVSSVSGSGAGTYYADSVKGRFTISRDNPKNTLYLQMNSLRAEDTAVYYCVKEGGSRGFDYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
- Component
- Light chain
- Type
- Protein
- Sequence
- DIQMTQSPSSLSASVGDRVTITCRASQDISNYLAWFQQKPGKAPKSLIYTASSLQSGVPSKFSGSGSGTDFTLTISSLQPEDFATYYCQQYNLYPPTFGQGTKVEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC
- Component
- Disulfide bridges
- Sequence
- 22-96 $ 22''-96'' $ 23'-88' $ 23'''-88''' $ 134'-194' $ 134'''-194''' $ 145-201 $ 145''-201'' $ 221-214' $ 221''-214''' $ 227-227'' $ 230-230'' $ 262-322 $ 262''-322'' $ 368-426 $ 368''-426''
- Component
- Glycosylation sites (N)
- Sequence
- 298 $ 298''
Related records
Trials (6)
- A Long-Term Safety and Efficacy Study of Verekitug (UPB-101) in Adult Participants With Severe Asthma (VALOUR)
- A Study to Assess the Efficacy and Safety of Verekitug in Participants With COPD
- A Study to Investigate the Efficacy and Safety of Verekitug (UPB-101) in Adult Participants With Severe Asthma (VALIANT)
- A Study to Investigate the Efficacy and Safety of Verekitug (UPB-101) in Participants With Chronic Rhinosinusitis With Nasal Polyps
- Safety and Biologic Impact (Pharmacodynamics) of Repeated Injections and Increasing Amounts of UPB-101 in Asthmatics
- Safety and Blood Levels After a Single Injection of UPB-101 in Healthy Japanese and Non-Japanese Non-East Asian Adults
In development for (2)
- Asthma Phase 1
- Chronic obstructive pulmonary disease Phase 2