Trosunilimab
Highest phase reached
Phase 2
Drug type
Antibody
- Listing at source
- Listed
- Highest phase reached
- Phase 2
- Drug type
- Antibody
- Drug name
- Trosunilimab
- abbv 382
- ABBV 382 [WHO-DD]
- abbv 382 who dd
- ABBV-382
- gamma1 heavy chain (1-442) [VH (Homo sapiens IGHV1-69*11 (80.0%) -(IGHD) -IGHJ3*01 (92.3%) M123>T (107), CDR-IMGT [8.8.5] (26-33.51-58.97-101)) (1-112) -Homo sapiens IGHG1*03v, G1m3>G1m17, nG1m1 (CH1 R120>K (209) (113-210), hinge 1-15 (211-225), CH2 (226-335), CH3 E12 (351), M14 (353) (336-440), CHS (441-442)) (113-442)], (215-214')-disulfide with kappa light chain (1'-214') [V-KAPPA Musmus/Homsap (Mus musculus IGKV14-100*01 (85.3%) -IGKJ1*01 (91.7%) L124>V (104)/Homo sapiens IGKV1-33*01 (80.0%) -IGKJ4*01 (100%), CDR-IMGT [6.3.9] (27-32.50-52.89-97)) (1'-107') -Homo sapiens IGKC*01 (100%), Km3 A45.1 (153), V101 (191) (108'-214')]; dimer (221-221'':224-224'')-bisdisulfide, produced in Chinese hamster ovary (CHO) cells, glycoform alfa
- gamma1 heavy chain 1 442 vh homo sapiens ighv1 69 11 80 0 ighd ighj3 01 92 3 m123 t 107 cdr imgt 8 8 5 26 33 51 58 97 101 1 112 homo sapiens ighg1 03v g1m3 g1m17 ng1m1 ch1 r120 k 209 113 210 hinge 1 15 211 225 ch2 226 335 ch3 e12 351 m14 353 336 440 chs 441 442 113 442 215 214 disulfide with kappa light chain 1 214 v kappa musmus homsap mus musculus igkv14 100 01 85 3 igkj1 01 91 7 l124 v 104 homo sapiens igkv1 33 01 80 0 igkj4 01 100 cdr imgt 6 3 9 27 32 50 52 89 97 1 107 homo sapiens igkc 01 100 km3 a45 1 153 v101 191 108 214 dimer 221 221 224 224 bisdisulfide produced in chinese hamster ovary cho cells glycoform alfa
- immunoglobulin g1 anti human integrin α4β7 human mus musculus monoclonal pr 1794842 γ1 chain disulfide with human mus musculus monoclonal pr 1794842 κ chain dimer
- immunoglobulin g1 kappa anti homo sapiens integrin itga4 itgb7 integrin alpha4 cd49d beta7 integrin α4β7 lymphocyte peyer s patch adhesion molecule 1 lpam 1
- immunoglobulin G1-kappa, anti-[Homo sapiens integrin ITGA4_ITGB7 (integrin alpha4 (CD49d)_beta7, integrin α4β7, lymphocyte Peyer's patch adhesion molecule 1, LPAM-1)]
- Immunoglobulin G1, anti-(human integrin α4β7) (human-Mus musculus monoclonal PR-1794842 γ1-chain), disulfide with human-Mus musculus monoclonal PR-1794842 κ-chain, dimer
- pr 1794842
- PR-1794842
- trosunilimab
- Trosunilimab
- trosunilimab [INN]
- TROSUNILIMAB [USAN]
- trosunilimab inn
- trosunilimab usan
- CAS registry numbers
- 2550297-60-2
- ChEMBL ID
- CHEMBL6068185
- FDA ingredient codes (UNII)
- LNN5K7KB5R
- First in class
- No
- Orphan designation
- No
- Drug name stem
- -mab
Open Targets indications
- Condition identifier
- MONDO_0005011
- Highest recorded phase
- 2
- Prodrug
- No
- Chirality
- Single enantiomer
- Inorganic
- No
- Natural product
- No
- Component
- Heavy chain
- Type
- Protein
- Sequence
- EVQLVQSGAEVKKPGSSVKVSCKASGENIKNTYMHWVRQAPGQGLEWIGRIDPAKGHTEYAPKFLGRVTITADESTNTAYMELSSLRSEDTAVYYCYYVDVWGQGTTVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPTEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVESCSVMHEALHNHYTQKSLSLSPGK
- Component
- Glycosylation sites (N)
- Sequence
- 292 $ 292''
- Component
- Disulfide bridges
- Sequence
- 22-96 $ 22''-96'' $ 23'-88' $ 23'''-88''' $ 134'-194' $ 134''-194''' $ 139-195 $ 139''-195'' $ 215-214' $ 215'-214''' $ 221-221'' $ 224-224'' $ 256-316 $ 256''-316'' $ 362-420 $ 362''420''
- Component
- Light chain
- Type
- Protein
- Sequence
- DIQMTQSPSSLSASVGDRVTITCHASQDISDNIGWLQQKPGKSFKLLIYHGTNLEDGVPSRESGSGSGTDYTLTISSLQPEDFATYYCVQYAQFPWTEGGGTKVEIKRTVRPSVEFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC
Related records
Trials (5)
- A Study to Assess Change in Disease Activity, Adverse Events, and How the Drug Moves Through the Body in Adult Participants Living With Human Immunodeficiency Virus (HIV) Receiving Intravenous (IV) Infusion or Subcutaneous (SC) Injection of Budigalimab and/or ABBV-382
- A Study to Evaluate Adverse Events and How the Drug Moves Through the Body From Subcutaneous (SC) and Intravenous (IV) Doses of ABBV-382 in Healthy Adult Chinese Volunteers
- Study of Advanced Therapies for the Treatment of Adult Participants With Moderately to Severely Active Crohn's Disease or Ulcerative Colitis
- Study of Targeted Therapies for the Treatment of Adult Participants With Moderate to Severe Crohn's Disease
- Study to Assess Adverse Events and How Intravenous (IV) or Subcutaneous (SC) ABBV-382 Moves Through the Body of Adult Participants With Human Immuno-Deficiency Virus (HIV-1)