Trontinemab
Highest phase reached
Phase 2
Drug type
Antibody
- Listing at source
- Listed
- Highest phase reached
- Phase 2
- Drug type
- Antibody
- Drug name
- Trontinemab
- immunoglobulin [G1-VH-Ckappa_Vkappa-CH1]_[G1_kappa] with domain crossover, anti-[Homo sapiens APP (amyloid beta, A4 precursor protein) Abeta, conformational epitope 1-40/42)] and anti- [Homo sapiens TFRC (transferrin receptor, p90, CD71)], humanized monoclonal antibody, bispecific; fused chain G1-VH-Ckappa bispecific, anti-APP A beta and anti-TFRC (1-702) [gamma1 heavy chain anti-APP Abeta (1-455) humanized [VH (Homo sapiens IGHV3-23*04 (92.9%) -(IGHD) -IGHJ4*01 (93.3%), CDR-IMGT [8.8.19] (26-33.51-58.97-115)) (1-126) -Homo sapiens IGHG1*01, G1m17,1, G1v32 CH3 W22 (CH1 K26>E (156), K119>E (222), K120 (223) (127-224), hinge 1-15 (225-239), CH2 (240-349), CH3 S10>C (363), D12 (365), L14 (367), T22>W (375) (350-454), CHS K2>del (455)) (127-455)] -18-mer diglycyl-seryl-tris(tetraglycyl-seryl) linker (456-473) -VH-Ckappa chain anti-TFRC (474-702) humanized [VH (Homo sapiens IGHV4-31*02 (76.0%) -(IGHD) -IGHJ5*02 (100%), CDR-IMGT [8.7.19] (498-505.523-529.566-584)) (474-595) -alanylseryl (596-597) -C-KAPPA (Homo sapiens IGKC*01 (100%), Km3 A45.1 (641), V101 (679) (598-702)], (229-215''')-disulfide with kappa light chain anti-APP Abeta (1'''-215''') humanized [V-KAPPA (Homo sapiens IGKV3D-7*01 (89.6%) - IGKJ1*01 (100%), CDR-IMGT [7.3.9] (27-33.51-53.90-98)) (1'''-108''') - Homo sapiens IGKC*01 (100%), Km3 A45.1 (154), V101 (192), E12>R (124), Q13>K (125) (109'''-215''')], (702-215'''')-disulfide with Vkappa- CH1 chain anti-TFRC (1''''-215'''') humanized [V-KAPPA (Homo sapiens IGKV1-13*02 (94.4%) -IGKJ4*01 (100%), CDR-IMGT [6.3.12] (27- 32.50-52.89-100)) (1''''-110'''') -diseryl (111''''-112'''') -CH1-hinge (Homo sapiens IGHG1*01 CH1-h, G1m17 (CH1 K120 (209) (113''''-210''''), hinge 1-5 (211''''-215'''')) (113''''-215'''')], gamma1 heavy chain anti-APP Abeta (1''-456'') humanized [VH (Homo sapiens IGHV3-23*04 (92.9%) -(IGHD) -IGHJ4*01 (93.3%), CDR-IMGT [8.8.19] (26-33.51-58.97-115)) (1''-126'') -Homo sapiens IGHG1*01, G1m17,1, G1v33 CH3 S22, A24, V86 (CH1 K26>E (156), K119>E (222), K120 (223) (127''-224''), hinge 1-15 (225''-239''), CH2 (240''- 349''), CH3 Y5>C (358), D12 (365), L14 (367), T22>S (375), L24>A (377), Y86>V (416) (350''-454''), CHS (455''-456'')) (127''-456'')], (229''- 215''')-disulfide with kappa light chain anti-APP Abeta (1'''-215''') humanized [V-KAPPA (Homo sapiens IGKV3D-7*01 (89.6%) - IGKJ1*01 (100%), CDR-IMGT [7.3.9] (27-33.51-53.90-98)) (1'''-108''') - Homo sapiens IGKC*01 (100%), Km3 A45.1 (154), V101 (192) (109'''- 215''')], dimer (235-235'':238-238'':363-358'')-trisdisulfide, produced in Chinese hamster ovary (CHO) cells, glycoform alfa
- Immunoglobulin G1 [156-glutamic acid,222-glutamic acid,363-cysteine,375-tryptophan,de-456-lysine], anti-(human β-amyloid 1-40/42) (human clone mAb31 γ1-chain) fusion protein with peptide linker (GGS(GGGGS)3) fusion protein with immunoglobulin anti-(human transferrin receptor 1) (human-Oryctolagus cuniculus clone BBB-1026 heavy chain V-D-J region) fusion protein with immunoglobulin [1-alanine,2-serine] (human κ-chain C region), disulfide with immunoglobulin [endo-111-serine,endo-112-serine] anti-(human transferrin receptor 1) (human-Oryctolagus cuniculus clone BBB-1026 κ-chain V-J region) fusion protein with immunoglobulin G1 (human γ1-chain CH1 region), (235→235'),(238→238'),(358→363')- tris(disulfide) with immunoglobulin G1 [156-glutamic acid,222-glutamic acid,358-cysteine,375-serine,377-alanine,416-valine] anti-(human β-amyloid 1-40/42) (human clone mAb31 γ1-chain), disulfide with immunoglobulin G1 [124-arginine,125-lysine] anti-(human β-amyloid 1-40/42) (human clone mAb31 κ-chain)
- immunoglobulin g1 156 glutamic acid 222 glutamic acid 363 cysteine 375 tryptophan de 456 lysine anti human β amyloid 1 40 42 human clone mab31 γ1 chain fusion protein with peptide linker ggs ggggs 3 fusion protein with immunoglobulin anti human transferrin receptor 1 human oryctolagus cuniculus clone bbb 1026 heavy chain v d j region fusion protein with immunoglobulin 1 alanine 2 serine human κ chain c region disulfide with immunoglobulin endo 111 serine endo 112 serine anti human transferrin receptor 1 human oryctolagus cuniculus clone bbb 1026 κ chain v j region fusion protein with immunoglobulin g1 human γ1 chain ch1 region 235 235 238 238 358 363 tris disulfide with immunoglobulin g1 156 glutamic acid 222 glutamic acid 358 cysteine 375 serine 377 alanine 416 valine anti human β amyloid 1 40 42 human clone mab31 γ1 chain disulfide with immunoglobulin g1 124 arginine 125 lysine anti human β amyloid 1 40 42 human clone mab31 κ chain
- immunoglobulin g1 vh ckappa vkappa ch1 g1 kappa with domain crossover anti homo sapiens app amyloid beta a4 precursor protein abeta conformational epitope 1 40 42 and anti homo sapiens tfrc transferrin receptor p90 cd71 humanized monoclonal antibody bispecific fused chain g1 vh ckappa bispecific anti app a beta and anti tfrc 1 702 gamma1 heavy chain anti app abeta 1 455 humanized vh homo sapiens ighv3 23 04 92 9 ighd ighj4 01 93 3 cdr imgt 8 8 19 26 33 51 58 97 115 1 126 homo sapiens ighg1 01 g1m17 1 g1v32 ch3 w22 ch1 k26 e 156 k119 e 222 k120 223 127 224 hinge 1 15 225 239 ch2 240 349 ch3 s10 c 363 d12 365 l14 367 t22 w 375 350 454 chs k2 del 455 127 455 18 mer diglycyl seryl tris tetraglycyl seryl linker 456 473 vh ckappa chain anti tfrc 474 702 humanized vh homo sapiens ighv4 31 02 76 0 ighd ighj5 02 100 cdr imgt 8 7 19 498 505 523 529 566 584 474 595 alanylseryl 596 597 c kappa homo sapiens igkc 01 100 km3 a45 1 641 v101 679 598 702 229 215 disulfide with kappa light chain anti app abeta 1 215 humanized v kappa homo sapiens igkv3d 7 01 89 6 igkj1 01 100 cdr imgt 7 3 9 27 33 51 53 90 98 1 108 homo sapiens igkc 01 100 km3 a45 1 154 v101 192 e12 r 124 q13 k 125 109 215 702 215 disulfide with vkappa ch1 chain anti tfrc 1 215 humanized v kappa homo sapiens igkv1 13 02 94 4 igkj4 01 100 cdr imgt 6 3 12 27 32 50 52 89 100 1 110 diseryl 111 112 ch1 hinge homo sapiens ighg1 01 ch1 h g1m17 ch1 k120 209 113 210 hinge 1 5 211 215 113 215 gamma1 heavy chain anti app abeta 1 456 humanized vh homo sapiens ighv3 23 04 92 9 ighd ighj4 01 93 3 cdr imgt 8 8 19 26 33 51 58 97 115 1 126 homo sapiens ighg1 01 g1m17 1 g1v33 ch3 s22 a24 v86 ch1 k26 e 156 k119 e 222 k120 223 127 224 hinge 1 15 225 239 ch2 240 349 ch3 y5 c 358 d12 365 l14 367 t22 s 375 l24 a 377 y86 v 416 350 454 chs 455 456 127 456 229 215 disulfide with kappa light chain anti app abeta 1 215 humanized v kappa homo sapiens igkv3d 7 01 89 6 igkj1 01 100 cdr imgt 7 3 9 27 33 51 53 90 98 1 108 homo sapiens igkc 01 100 km3 a45 1 154 v101 192 109 215 dimer 235 235 238 238 363 358 trisdisulfide produced in chinese hamster ovary cho cells glycoform alfa
- RECOMBINANT (2+1) BISPECIFIC HUMANIZED MONOCLONAL ANTI-A-BETA PEPTIDE AND BINDS TO TRANSFERRIN RECEPTOR (TFR).
- recombinant 2 1 bispecific humanized monoclonal anti a beta peptide and binds to transferrin receptor tfr
- rg 6102
- RG-6102
- rg6102
- RG6102
- ro 7126209
- RO-7126209
- ro7126209
- RO7126209
- trontinemab
- Trontinemab
- trontinemab [INN]
- TRONTINEMAB [USAN]
- trontinemab inn
- trontinemab usan
- CAS registry numbers
- 2568868-35-7
- ChEMBL ID
- CHEMBL5095377
- FDA ingredient codes (UNII)
- N0GBZ1GWC2
- First in class
- No
- Orphan designation
- No
- Drug name stem
- -mab
Investigated indications
- Condition
- Alzheimer Disease
- Highest recorded phase
- 1
- Condition identifier
- MONDO:0004975
- Subject identifier
- D000544
Open Targets indications
- Condition identifier
- MONDO_0004975
- Highest recorded phase
- 3
- NCT04023994
- NCT04639050
- Prodrug
- No
- Chirality
- Single enantiomer
- Inorganic
- No
- Natural product
- No
- Component
- Glycosylation sites (N)
- Sequence
- 1 $ 1'''' $ 52 $ 52'''' $ 306 $ 306''''
- Component
- Heavy chain: (anti-APP beta 1-40/42, anti-TFRC)
- Type
- Protein
- Sequence
- QVELVESGGGLVQPGGSLRLSCAASGFTFSSYAMSWVRQAPGKGLEWVSAINASGTRTYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARGKGNTHKPYGYVRYFDVWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVEDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDEKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPCRDELTKNQVSLWCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGGGSGGGGSGGGGSGGGGSQSMQESGPGLVKPSQTLSLTCTVSGFSLSSYAMSWIRQHPGKGLEWIGYIWSGGSTDYASWAKSRVTISKTSTTVSLKLSSVTAADTAVYYCARRYGTSYPDYGDASGFDPWGQGTLVTVSSASVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC
- Component
- Heavy chain: (anti-APP A beta 1-40/42)
- Type
- Protein
- Sequence
- QVELVESGGGLVQPGGSLRLSCAASGFTFSSYAMSWVRQAPGKGLEWVSAINASGTRTYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARGKGNTHKPYGYVRYFDVWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVEDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDEKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVCTLPPSRDELTKNQVSLSCAVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLVSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
- Component
- Glycosylation sites (N)
- Sequence
- 1 $ 1'' $ 52 $ 52'' $ 306 $ 306''
- Component
- Disulfide bridges
- Sequence
- 22-96 $ 22''-96'' $ 23'-88' $ 23'''-89''' $ 139'-195' $ 135'''-195''' $ 153-209 $ 153''-209'' $ 229-215' $ 229''-215''' $ 235-235'' $ 238-238'' $ 270-330 $ 270''-330'' $ 363-358'' $ 376-434 $ 376''-434'' $ 494-565 $ 622-682 $ 702-215''''
- Component
- Light chain: (Vkappa-CH1, anti-TFRC)
- Type
- Protein
- Sequence
- AIQLTQSPSSLSASVGDRVTITCRASQSISSYLAWYQQKPGKAPKLLIYRASTLASGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQNYASSNVDNTFGGGTKVEIKSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSC
- Component
- Light chain: (kappa, anti-APP Abeta 140/42)
- Type
- Protein
- Sequence
- DIVLTQSPATLSLSPGERATLSCRASQSVSSSYLAWYQQKPGQAPRLLIYGASSRATGVPARFSGSGSGTDFTLTISSLEPEDFATYYCLQIYNMPITFGQGTKVEIKRTVAAPSVFIFPPSDRKLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC
Related records
Trials (5)
- A Clinical Trial of Trontinemab in Participants With Early Symptomatic Alzheimer's Disease
- A Single Ascending Dose Study to Investigate the Safety, Tolerability, Immunogenicity and Pharmacokinetics of Intravenously Administered RO7126209 in Healthy Participants
- A Study of Trontinemab in Cognitively Unimpaired Individuals at Risk for Progression to Symptomatic Alzheimer's Disease
- A Study of Trontinemab in Participants With Early Symptomatic Alzheimer's Disease
- Brainshuttle AD: A Multiple Ascending Dose Study to Investigate the Safety, Tolerability, Pharmacokinetics, and Pharmacodynamics of RO7126209 Following Intravenous Infusion in Participants With Prodromal or Mild to Moderate Alzheimer's Disease
In development for (1)
- Alzheimer disease Phase 1