Tozorakimab
Highest phase reached
Phase 3
Drug type
Antibody
- Listing at source
- Listed
- Highest phase reached
- Phase 3
- Drug type
- Antibody
- Drug name
- Tozorakimab
- immunoglobulin g1 anti human interleukin 33 human monoclonal medi3506 γ1 chain disulfide with human monoclonal medi3506 λ chain dimer
- immunoglobulin g1 lambda2 anti homo sapiens il33 interleukin 33 dvs27 nf hev il1f11 monoclonal antibody gamma1 heavy chain 1 456 vh homo sapiens ighv3 23 01 93 9 ighd ighj4 01 85 7 l123 m 121 cdr imgt 8 8 19 26 33 51 58 97 115 1 126 homo sapiens ighg1 03 100 g1m3 ng1m1 ch1 r120 223 127 224 hinge 1 15 225 239 ch2 240 349 ch3 e12 365 m14 367 350 454 chs 455 456 127 456 229 211 disulfide with lambda2 light chain 1 212 v lambda homo sapiens iglv3 1 01 86 2 iglj2 01 100 cdr imgt 6 3 9 26 31 49 51 88 96 1 106 homo sapiens iglc2 01 100 107 212 dimer 235 235 238 238 bisdisulfide produced in a chinese hamster ovary cho cell line derived from cho k1 glycoform alfa
- Immunoglobulin G1-lambda2, anti-[Homo sapiens IL33 (interleukin 33, DVS27, NF-HEV, IL1F11)], monoclonal antibody; gamma1 heavy chain (1-456) [VH (Homo sapiens IGHV3-23*01 (93.9%) -(IGHD) -IGHJ4*01 (85.7%) L123>M (121)) CDR-IMGT [8.8.19] (26-33.51-58.97-115) (1-126) -Homo sapiens IGHG1*03 (100%) G1m3, nG1m1 (CH1 R120 (223) (127-224), hinge 1-15 (225-239), CH2 (240-349), CH3 E12 (365), M14 (367) (350-454), CHS (455-456)) (127-456)], (229-211')-disulfide with lambda2 light chain (1'-212') [V-LAMBDA (Homo sapiens IGLV3-1*01 (86.2%) -IGLJ2*01 (100%)) CDR-IMGT [6.3.9] (26-31.49-51.88-96) (1'-106') -Homo sapiens IGLC2*01 (100%) (107'-212')]; dimer (235-235'':238-238'')-bisdisulfide, produced in a Chinese hamster ovary (CHO) cell line derived from CHO-K1, glycoform alfa
- Immunoglobulin G1, anti-(human interleukin 33) (human monoclonal MEDI3506 γ1-chain), disulfide with human monoclonal MEDI3506 λ-chain, dimer
- medi 3506
- Medi 3506
- MEDI-3506
- medi3506
- Medi3506
- MEDI3506
- tozorakimab
- Tozorakimab
- tozorakimab [INN]
- TOZORAKIMAB [USAN]
- Tozorakimab [WHO-DD]
- tozorakimab inn
- tozorakimab usan
- tozorakimab who dd
- CAS registry numbers
- 2376858-66-9
- ChEMBL ID
- CHEMBL4650490
- FDA ingredient codes (UNII)
- OHZ2MEL7FD
- First in class
- No
- Orphan designation
- No
- Pharmacology name
- tozorakimab
- Type
- Antibody
- Drug name stem
- -mab
Mechanisms of action
- Action
- Binding
- Action type
- Binding
- Target
- IL-33
- Gene symbol
- IL-33
- Median affinity
- 10.09
- Affinity units
- pIC50
- Condition
- Dermatitis, Atopic
- Highest recorded phase
- 2
- Condition identifier
- EFO:0000274
- Subject identifier
- D003876
- Condition
- Pulmonary Disease, Chronic Obstructive
- Highest recorded phase
- 3
- Condition identifier
- EFO:0000341
- Subject identifier
- D029424
- Condition
- Diabetic Nephropathies
- Highest recorded phase
- 2
- Condition identifier
- EFO:0000401
- Subject identifier
- D003928
- Condition
- Bronchitis, Chronic
- Highest recorded phase
- 2
- Condition identifier
- EFO:0006505
- Subject identifier
- D029481
- Condition
- Dermatitis
- Highest recorded phase
- 1
- Condition identifier
- HP:0011123
- Subject identifier
- D003872
- Condition
- Asthma
- Highest recorded phase
- 2
- Condition identifier
- MONDO:0004979
- Subject identifier
- D001249
- Condition identifier
- EFO_0000274
- Highest recorded phase
- 2
- Condition identifier
- EFO_0000341
- Highest recorded phase
- 3
- Condition identifier
- EFO_0000401
- Highest recorded phase
- 2
- Condition identifier
- EFO_0006505
- Highest recorded phase
- 2
- Condition identifier
- HP_0011123
- Condition identifier
- MONDO_0001208
- Highest recorded phase
- 3
- Condition identifier
- MONDO_0004979
- Highest recorded phase
- 2
- Condition identifier
- MONDO_0004980
- Highest recorded phase
- 2
- Condition identifier
- MONDO_0005002
- Highest recorded phase
- 3
- Condition identifier
- MONDO_0005016
- Highest recorded phase
- 2
- Condition identifier
- MONDO_0005607
- Highest recorded phase
- 2
- NCT03096795
- NCT05158387
- NCT05166889
- NCT06040086
- NCT04170543
- NCT04212169
- NCT04570657
- NCT04631016
- Prodrug
- No
- Chirality
- Single enantiomer
- Inorganic
- No
- Natural product
- No
- Component
- Heavy chain
- Type
- Protein
- Sequence
- EVQLLESGGGLVQPGGSLRLSCAASGFTFSSYAMSWVRQAPGKGLEWVSGISAIDQSTYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARQKFMQLWGGGLRYPFGYWGQGTMVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
- Component
- Glycosylation sites (N)
- Sequence
- 306 $ 306''''
- Component
- Glycosylation sites (N)
- Sequence
- 306 $ 306''
- Component
- Disulfide bridges
- Sequence
- 22-96 $ 22''-96'' $ 22'-87' $ 22'''-87''' $ 134'-193' $ 134'''-193''' $ 153-209 $ 153''-209'' $ 229-211' $ 229''-211''' $ 235-235'' $ 238-238'' $ 270-330 $ 270''-330'' $ 376-434 $ 376''-434''
- Component
- Light chain
- Type
- Protein
- Sequence
- SYVLTQPPSVSVSPGQTASITCSGEGMGDKYAAWYQQKPGQSPVLVIYRDTKRPSGIPERFSGSNSGNTATLTISGTQAMDEADYYCGVIQDNTGVFGGGTKLTVLGQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPTECS
Related records
Trials (16)
- A Phase 2b Diabetic Kidney Disease Study
- A Phase II, Randomized, Double-blind, Placebo-controlled Study to Assess MEDI3506 in Participants With COPD and Chronic Bronchitis
- A Study to Investigate Efficacy and Safety of Tozorakimab Injections Compared With Placebo in Adult Participants With Symptomatic Chronic Obstructive Pulmonary Disease (COPD) With a History of COPD Exacerbations and Elevated Eosinophils
- A Study to Investigate Relative Bioavailability of Two Different Dosage Forms for Tozorakimab Via Subcutaneous Administration in Healthy Volunteers
- An Accessorised Prefilled Syringe to an Autoinjector Pharmacokinetic Bridging Study of Tozorakimab
- Dose Range Finding Study to Assess Efficacy and Safety of Tozorakimab in Adults With Uncontrolled Asthma on Medium-to-High Dose Inhaled Corticosteroids
- Efficacy and Safety of MEDI3506 in Adult Subjects With Atopic Dermatitis
- Efficacy and Safety of Tozorakimab in Patients Hospitalised for Viral Lung Infection Requiring Supplemental Oxygen
- Efficacy and Safety of Tozorakimab in Symptomatic Chronic Obstructive Pulmonary Disease With a History of Exacerbations
- Efficacy and Safety of Tozorakimab in Symptomatic Chronic Obstructive Pulmonary Disease With a History of Exacerbations
- Efficacy and Safety of Tozorakimab in Symptomatic Chronic Obstructive Pulmonary Disease With a History of Exacerbations.
- Long-term Efficacy and Safety of Tozorakimab in Participants With Chronic Obstructive Pulmonary Disease With a History of Exacerbations (PROSPERO).
- Long-term Safety and Tolerability of Tozorakimab in Patients With COPD and History of Exacerbations
- Pharmacokinetics, Immunogenicity, Safety and Tolerability of MEDI3506 in Health Chinese Participants
- Safety and Tolerability of MEDI3506 in Healthy Participants, in Participants With COPD and Healthy Japanese Participants
- Study to Assess the Efficacy and Safety of MEDI3506 in Adults With Uncontrolled Moderate-to-severe Asthma
In development for (7)
- Acute respiratory failure Phase 3
- Asthma Phase 2
- Atopic eczema Phase 2
- Chronic bronchitis Phase 2
- Chronic obstructive pulmonary disease Phase 3
- Dermatitis Phase 1
- Diabetic kidney disease Phase 2