Tobevibart
Highest phase reached
Phase 2
Drug type
Antibody
- Listing at source
- Listed
- Highest phase reached
- Phase 2
- Drug type
- Antibody
- Drug name
- Tobevibart
- hbc34 v35 ls xx2
- HBC34-v35-LS-XX2
- Immunoglobulin G1 [238-alanine,332-leucine,334-glutamic acid,430-leucine,436-serine], anti-(hepatitis B virus surface antigen) (human monoclonal VIR-3434 γ1-chain), disulfide with human monoclonal VIR-3434 λ-chain, dimer
- immunoglobulin g1 238 alanine 332 leucine 334 glutamic acid 430 leucine 436 serine anti hepatitis b virus surface antigen human monoclonal vir 3434 γ1 chain disulfide with human monoclonal vir 3434 λ chain dimer
- ls gaalie
- LS-GAALIE
- tobevibart
- Tobevibart
- tobevibart [INN]
- TOBEVIBART [USAN]
- tobevibart inn
- tobevibart usan
- vir 3434
- Vir-3434
- VIR-3434
- vir3434
- VIR3434
- CAS registry numbers
- 2645440-65-7
- ChEMBL ID
- CHEMBL5314621
- FDA ingredient codes (UNII)
- PL93ZHC4L3
- First in class
- No
- Orphan designation
- No
- Drug name stem
- -bart
- Condition
- Hepatitis B
- Highest recorded phase
- 1
- Condition identifier
- EFO:0004197
- Subject identifier
- D006509
- Condition
- Hepatitis B, Chronic
- Highest recorded phase
- 2
- Condition identifier
- EFO:0004239
- Subject identifier
- D019694
- Condition
- Hepatitis D
- Highest recorded phase
- 2
- Condition identifier
- EFO:0007304
- Subject identifier
- D003699
- Condition identifier
- EFO_0004197
- Highest recorded phase
- 1
- Condition identifier
- EFO_0004239
- Highest recorded phase
- 2
- Condition identifier
- EFO_0007304
- Highest recorded phase
- 2
- Condition identifier
- MONDO_0005344
- Highest recorded phase
- 2
- Condition identifier
- MONDO_0005366
- Highest recorded phase
- 2
- Condition identifier
- MONDO_0005789
- Highest recorded phase
- 3
- NCT04423393
- NCT04856085
- NCT05612581
- NCT06216470
- NCT05461170
- Prodrug
- No
- Chirality
- Single enantiomer
- Inorganic
- No
- Natural product
- No
- Component
- Heavy chain
- Type
- Protein
- Sequence
- ELQLVESGGGWVQPGGSQRLSCAASGRIFRSFYMSWVRQAPGKGLEWVATINQDGSEKLYVDSVKGRFTISRDNAKNSLFLQMNNLRVEDTAVYYCAAWSGNSGGMDVWGQGTTVSVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLAGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPLPEEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVLHEALHSHYTQKSLSLSPGK
- Component
- Disulfide bridges
- Sequence
- 22'-87' $ 22'''-87''' $ 22-96 $ 22''-96'' $ 134'-193' $ 134'''-193''' $ 146-202 $ 146''-202'' $ 222-211' $ 222''-211'' $ 228-228'' $ 231-231'' $ 263-323 $ 263''-323'' $ 369-427 $ 369''-427''
- Component
- Light chain
- Type
- Protein
- Sequence
- SYELTQPPSVSVSPGQTVSIPCSGDKLGNKNVAWFQHKPGQSPVLVIYEVKYRPSGIPERFSGSNSGNTATLTISGTQAMDEAAYFCQTFDSTTVVFGGGTRLTVLGQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPTECS
- Component
- Glycosylation sites (N)
- Sequence
- 299 $ 299''
Related records
Trials (10)
- A Platform Study to Evaluate Investigational Therapies in Chronic Hepatitis B Infection
- A Study to Evaluate Tobevibart + Elebsiran in Chronic HDV Infection
- A Study to Evaluate Tobevibart+Elebsiran in Participants With Chronic HDV Infection Not Virologically Suppressed With Bulevirtide
- A Study to Evaluate Tobevibart+Elebsiran Versus Bulevirtide in Chronic HDV Infection
- Dose-Escalation Prime/Boost Therapeutic Vaccination Study Of 2 Chimp Adenoviral Vectors in Adults With Chronic HBV On Nucleos(t)Ide Therapy
- Effect of Hepatic Impairment on the Pharmacokinetics and Safety of VIR-2218 and VIR-3434
- SOLSTICE: Combination Therapy for the Treatment of Chronic Hepatitis D Infection.
- Study of VIR-2218, VIR-3434, and/or PEG-IFNα in Subjects With Chronic Hepatitis B Virus Infection
- Study of VIR-3434 in Healthy Volunteers and Patients With Chronic Hepatitis B Virus Infection
- Vaccinal Effect of HBsAg Monoclonal Ab VIR-3434 in Chronic Hepatitis B Infection [VISION]
In development for (3)
- Chronic hepatitis B virus infection Phase 2
- Hepatitis B virus infection Phase 1
- Hepatitis D virus infection Phase 2