Temtokibart
Highest phase reached
Phase 2
Drug type
Antibody
- Listing at source
- Listed
- Highest phase reached
- Phase 2
- Drug type
- Antibody
- Drug name
- Temtokibart
- clone 230c9
- clone 230C9
- il 22r
- IL-22R
- Immunoglobulin G1 [300-glutamine], anti-(human interleukin 22 receptor) (human-Lama glama monoclonal LEO 138559 γ1-chain), disulfide with human-Lama glama monoclonal LEO 138559 λ-chain, dimer
- immunoglobulin g1 300 glutamine anti human interleukin 22 receptor human lama glama monoclonal leo 138559 γ1 chain disulfide with human lama glama monoclonal leo 138559 λ chain dimer
- immunoglobulin g1 lambda2 anti homo sapiens il22ra1 interleukin 22 receptor subunit alpha 1 il22r humanized monoclonal antibody gamma1 heavy chain humanized 1 450 vh homo sapiens ighv3 nl1 01 89 8 ighd ighj5 01 92 3 cdr imgt 8 8 13 26 33 51 58 97 109 1 120 homo sapiens ighg1 01 g1m17 1 ch1 k120 ch3 d12 l14 ighg1v36 ch2 q84 4 ch1 k120 217 121 218 hinge 1 15 219 233 ch2 n84 4 q 300 234 343 ch3 d12 359 l14 361 344 448 chs 449 450 121 450 223 208 disulfide with lambda light chain humanized 1 209 v lambda homo sapiens iglv3 9 02 80 9 iglj2 01 100 cdr imgt 2 3 10 26 27 45 47 84 93 1 103 homo sapiens iglc2 01 100 104 209 dimer 229 229 232 232 bisdisulfide produced in chinese hamster ovary cho cells cell line cho k1sv lacking the glutamine synthetase gs ko gene non glycosylated
- immunoglobulin G1-lambda2, anti-[Homo sapiens IL22RA1 interleukin 22 receptor subunit alpha 1, IL22R)], humanized monoclonal antibody (gamma1 heavy chain humanized (1-450) [VH (Homo sapiens IGHV3-NL1*01 (89.8%) -(IGHD) -IGHJ5*01(92.3%), CDR-IMGT [8.8.13] (26-33.51-58.97-109)) (1-120) -Homo sapiens IGHG1*01, G1m17,1 CH1 K120, CH3 D12, L14, IGHG1v36 CH2 Q84.4 (CH1 K120 (217) (121-218), hinge 1-15 (219-233), CH2 N84.4>Q (300) (234-343), CH3 D12 (359), L14 (361) (344-448), CHS (449-450)) (121-450)], (223-208')-disulfide with lambda light chain humanized (1'-209') [V-LAMBDA (Homo sapiens IGLV3-9*02 (80.9%) -IGLJ2*01 (100%), CDR-IMGT [2.3.10] (26-27.45-47.84-93)) (1'-103') -Homo sapiens IGLC2*01 (100%) (104'-209')]; dimer (229-229'':232-232'')-bisdisulfide, produced in Chinese hamster ovary (CHO) cells, cell line CHO-K1SV lacking the glutamine synthetase (GS-KO) gene, non-glycosylated)
- leo 138559
- LEO 138559
- LEO-138559
- leo138559
- LEO138559
- temtokibart
- Temtokibart
- temtokibart [INN]
- TEMTOKIBART [USAN]
- temtokibart inn
- temtokibart usan
- CAS registry numbers
- 2639874-57-8
- ChEMBL ID
- CHEMBL5314778
- FDA ingredient codes (UNII)
- V2XME9F5SF
- First in class
- No
- Orphan designation
- No
- Drug name stem
- -bart
- Condition
- Dermatitis
- Highest recorded phase
- 1
- Condition identifier
- HP:0011123
- Subject identifier
- D003872
- Condition
- Inflammation
- Highest recorded phase
- 2
- Condition identifier
- MP:0001845
- Subject identifier
- D007249
- Condition identifier
- EFO_0000274
- Highest recorded phase
- 2
- Condition identifier
- HP_0011123
- Condition identifier
- MONDO_0002406
- Condition identifier
- MONDO_0004980
- Highest recorded phase
- 2
- Condition identifier
- MP_0001845
- Prodrug
- No
- Chirality
- Single enantiomer
- Inorganic
- No
- Natural product
- No
- Component
- Heavy chain
- Type
- Protein
- Sequence
- QVQLVESGGGLVQPGGSLRLSCAASGFTESSYDMNWVRQAPGKGLEWVSSIYNDASNTAYSDSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAKVGFSGTYYSESWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLEPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKENWYVDGVEVHNAKTKPREEQYQSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVESCSVMHEALHNHYTQKSLSLSPGK
- Component
- Disulfide bridges
- Sequence
- 22-96 $ 22''-96'' $ 22'-83' $ 22'''-83''' $ 131'-190' $ 131'''-190''' $ 147-203 $ 147''-203'' $ 223-208' $ 223''-208''' $ 229-229'' $ 232-232'' $ 264-324 $ 264''-324'' $ 370-428 $ 370''-428''
- Component
- Light chain
- Type
- Protein
- Sequence
- SYELTQPSSVSVALGQTARITCQGGYYAHWYQQKPGQAPVLVIYGQNNRPSGIPERFSGSGAGNTATLTISRAQAEDEADYYCQSGSSSSNAVFGGGTKLTVLGQPKAAPSVTLEPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPTECS
- Component
- Glycosylation sites (N)
- Sequence
- 300 $ 300''
Related records
Trials (5)
- A Multi-omics Disease Signature Trial in Adult Patients With Moderate to Severe AD
- A Trial to Evaluate Pharmacokinetics, Immunogenicity, Safety, and Tolerability of LEO 138559 in Healthy Japanese Subjects
- A Trial to Evaluate the Efficacy and Safety of Different Doses of LEO 138559 in Adults With Moderate-to-severe Atopic Dermatitis
- An Evaluation of LEO 138559 in Adults With Moderate to Severe Atopic Dermatitis.
- Safety and Tolerability of LEO 138559 in Healthy Subjects and Subjects With Atopic Dermatitis
In development for (2)
- Atopic eczema Phase 2
- Dermatitis Phase 1