Tecotabart vedotin
Highest phase reached
Phase 2
Drug type
Antibody
- Listing at source
- Listed
- Highest phase reached
- Phase 2
- Drug type
- Antibody
- Drug name
- Tecotabart vedotin
- antibody drug conjugate composed of a humanized monoclonal antibody targeting cldn18 2 and linker payload mc vc pab mmae
- Antibody drug conjugate composed of a humanized monoclonal antibody targeting CLDN18.2 and linker-payload MC-VC-PAB-MMAE
- h gamma1 heavy chain humanized 1 449 vh homo sapiens ighv3 48 01 88 8 ighd ighj4 01 100 cdr imgt 8 8 12 26 33 51 58 97 108 1 119 homo sapiens ighg1 01 g1m17 1 ch1 k120 ch3 d12 l14 g1v7 ch2 d3 e117 ch1 k120 216 120 217 hinge 1 15 218 232 ch2 s3 d 241 i117 e 334 233 342 ch3 d12 358 l14 360 343 447 chs 448 449 120 449 222 220 disulfide with l kappa light chain humanized 1 220 v kappa homo sapiens igkv4 1 01 90 1 igkj2 02 90 9 cdr imgt 12 3 9 27 38 56 58 95 103 1 113 homo sapiens igkc 01 100 km3 a45 1 159 v101 197 114 220 dimer 228 228 231 231 bisdisulfide produced in chinese hamster ovary cho cells cell line cho k1 glycoform alfa substituted at the sulfur atoms of four l cysteinyl residues on an average among 222 228 231 220 222 228 231 and 220 with radical group 3rs 1 6 2s 1 2s 5 carbamoylamino 1 4 2s 1 2s 1 3r 4s 5s 1 2s 2 1r 2r 3 1s 2r 1 hydroxy 1 phenylpropan 2 yl amino 1 methoxy 2 methyl 3 oxopropyl pyrrolidin 1 yl 3 methoxy 5 methyl 1 oxoheptan 4 yl methyl amino 3 methyl 1 oxobutan 2 yl amino 3 methyl 1 oxobutan 2 yl methyl carbamoyl oxy methyl anilino 1 oxopentan 2 yl amino 3 methyl 1 oxobutan 2 yl amino 6 oxohexyl 2 5 dioxopyrrolidin 3 yl vedotin
- H-gamma1 heavy chain humanized (1-449) [VH (Homo sapiens IGHV3-48*01 (88.8%) -(IGHD) -IGHJ4*01 (100%), CDR-IMGT [8.8.12] (26-33.51-58.97-108)) (1-119) -Homo sapiens IGHG1*01, G1m17,1 CH1 K120, CH3 D12, L14, G1v7 CH2 D3, E117 (CH1 K120 (216) (120-217), hinge 1-15 (218-232), CH2 S3>D (241), I117>E (334) (233-342), CH3 D12 (358), L14 (360) (343-447), CHS (448-449)) (120-449)], (222-220')-disulfide with L-kappa light chain humanized (1'-220') [V-KAPPA (Homo sapiens IGKV4-1*01 (90.1%) -IGKJ2*02 (90.9%), CDR-IMGT [12.3.9] (27'-38'.56'-58'.95'-103')) (1'-113') -Homo sapiens IGKC*01 (100%), Km3 A45.1 (159'), V101 (197') (114'-220')]; dimer (228-228'':231-231'')-bisdisulfide, produced in Chinese hamster ovary (CHO) cells, cell line CHO-K1, glycoform alfa; substituted at the sulfur atoms of four L-cysteinyl residues on an average among 222, 228, 231, 220', 222'', 228'', 231'' and 220''' with radical group (3RS)-1-(6-{[(2S)-1-{[(2S)-5-(carbamoylamino)-1-{4-[({[(2S)-1-{[(2S)-1-{[(3R,4S,5S)-1-{(2S)-2-[(1R,2R)-3-{[(1S,2R)-1-hydroxy-1-phenylpropan-2-yl]amino}-1-methoxy-2-methyl-3-oxopropyl]pyrrolidin-1-yl}-3-methoxy-5-methyl-1-oxoheptan-4-yl](methyl)amino}-3-methyl-1-oxobutan-2-yl]amino}-3-methyl-1-oxobutan-2-yl](methyl)carbamoyl}oxy)methyl]anilino}-1-oxopentan-2-yl]amino}-3-methyl-1-oxobutan-2-yl]amino}-6-oxohexyl)-2,5-dioxopyrrolidin-3-yl (vedotin)
- Immunoglobulin G1 [241-aspartic acid,334-glutamic acid], anti-(human/Mus musculus/Macaca/Rattus claudin CLDN18.2) (human-Mus musculus monoclonal LM-102 γ1-chain), disulfide with human-Mus musculus monoclonal LM-102 κ-chain, dimer, tetrakis(thioether) with N-[[[4-[[N-[6-(3-mercapto-2,5-dioxo-1-pyrrolidinyl)-1-oxohexyl]-L-valyl-N5-(aminocarbonyl)-L-ornithyl]amino]phenyl]methoxy]carbonyl]-N-methyl-L-valyl-N-[(1S,2R)-4-[(2S)-2-[(1R,2R)-3-[[(1R,2S)-2-hydroxy-1-methyl-2-phenylethyl]amino]-1-methoxy-2-methyl-3-oxopropyl]-1-pyrrolidinyl]-2-methoxy-1-[(1S)-1-methylpropyl]-4-oxobutyl]-N-methyl-L-valinamide
- immunoglobulin g1 241 aspartic acid 334 glutamic acid anti human mus musculus macaca rattus claudin cldn18 2 human mus musculus monoclonal lm 102 γ1 chain disulfide with human mus musculus monoclonal lm 102 κ chain dimer tetrakis thioether with n 4 n 6 3 mercapto 2 5 dioxo 1 pyrrolidinyl 1 oxohexyl l valyl n5 aminocarbonyl l ornithyl amino phenyl methoxy carbonyl n methyl l valyl n 1s 2r 4 2s 2 1r 2r 3 1r 2s 2 hydroxy 1 methyl 2 phenylethyl amino 1 methoxy 2 methyl 3 oxopropyl 1 pyrrolidinyl 2 methoxy 1 1s 1 methylpropyl 4 oxobutyl n methyl l valinamide
- immunoglobulin g1 kappa anti homo sapiens cldn18 claudin 18 claudin 18 surfactant associated protein j sftpj humanized monoclonal antibody conjugated on an average of 4 cysteinyl residues via a cleavable linker to monomethylauristatin e mmae
- immunoglobulin G1-kappa, anti-[Homo sapiens CLDN18 (claudin 18, claudin-18, surfactant associated protein J, SFTPJ)], humanized monoclonal antibody; conjugated on an average of 4 cysteinyl residues via a cleavable linker to monomethylauristatin E (MMAE)
- lm 302
- LM-302
- tecotabart vedotin
- Tecotabart vedotin
- tecotabart vedotin [INN]
- tecotabart vedotin inn
- tecotabart vedotina
- Tecotabart vedotina
- tecotabart vedotine
- Tecotabart vedotine
- tpx 4589
- TPX-4589
- CAS registry numbers
- 2823357-33-9
- ChEMBL ID
- CHEMBL6068180
- FDA ingredient codes (UNII)
- 9GK5GYD8DQ
- First in class
- No
- Orphan designation
- No
- Drug name stem
- -bart; -dotin
Investigated indications
- Condition
- Neoplasms
- Highest recorded phase
- 2
- Condition identifier
- EFO:0000616
- Subject identifier
- D009369
- Condition identifier
- EFO_0000616
- Condition identifier
- MONDO_0003219
- Highest recorded phase
- 3
- Condition identifier
- MONDO_0005036
- Highest recorded phase
- 3
- Condition identifier
- MONDO_0005070
- Prodrug
- No
- Chirality
- Single enantiomer
- Inorganic
- No
- Natural product
- No
- Component
- Heavy chain
- Type
- Protein
- Sequence
- EVQLVESGGGLVQPGGSLRLSCAASGFTFSTFGMHWVRQAPGKGLEWVSYITSGESPIYFTDTVKGRFTISRDNAKNSLYLQMNSLRAEDTAVYYCARSSYYGNSMDYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPDVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPEEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
- Component
- Disulfide bridges
- Sequence
- 22-96 $ 22''-96'' $ 23'-94' $ 23'''-94''' $ 140'-200' $ 140'''-200''' $ 146-202 $ 146''-202'' $ 222-220' $ 222''-220''' $ 228-228'' $ 231-231'' $ 263-323 $ 263''-323'' $ 369-427 $ 369''-427''
- Component
- Light chain
- Type
- Protein
- Sequence
- DIVMTQSPDSLAVSLGERATINCRSSQSLLNAGNRKNYLTWYQQKPGQPPKLLIYWASTRESGVPDRFSGSGSGTDFTLTISSLQAEDVAVYYCQNAYSYPFTFGGGTKLEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC
- Component
- Glycosylation sites (N)
- Sequence
- 299 $ 299''
Related records
Trials (12)
- A LM-302 Combination With Other Anti-Tumor Therapies Phase ll Study
- Candonilimab in Combination With LM-302 for Claudin 18.2 Positive-advanced Biliary Tract Cancer After Failure of Standard of Chemotherapy and PD1/PD-L1 Antibody
- Clinical Study on the Efficacy and Safety of LM-302 Injection Combined With Tislelizumab and Tislelizumab Combined Chemotherapy for the Treatment of Gastric or Gastroesophageal Junction Adenocarcinoma.
- Efficacy and Safety of LM-302 Combined With Gemcitabine CLDN 18.2 Positive Unresectable Locally Advanced or Metastatic Pancreatic Cancer
- LM-302 and S-1 Plus Intraperitoneal Paclitaxel With or Without Cadonilimab for Claudin 18.2-positive Gastric or Gastroesophageal Junction Adenocarcinoma With Peritoneal Metastasis: a Prospective, Exploratory Study
- LM-302 for the Treatment of Subjects With Claudin18.2-Positive Gastric and Gastroesophageal Junction Adenocarcinoma.
- Neoadjuvant Tislelizumab + LM-302 + S-1 or Tislelizumab + SOX for CLDN18.2-Positive Gastric/GEJ Adenocarcinoma
- Study of LaNova Medicines(LM)-302 in Combination With Toripalimab in Patients With Advanced Solid Tumors
- Study of LM-302 in Patients With Advance Solid Tumors
- Study of Turning Point Therapeutics LM-302 in Patients With Advance Solid Tumors
- Systemic Application of Cadonilimab, LM-302, and S-1 Combined With Intraperitoneal Infusion of Paclitaxel for the Treatment of Claudin 18.2-positive Gastric Cancer With Peritoneal Metastasis
- The Efficacy and Safety of LM-302 in Combination With Candonilimab and Capecitabine for First-Line Treatment in Patients With Unresectable Advanced, Recurrent, or Metastatic CLDN18.2-Positive Gastric or Gastroesophageal Junction Adenocarcinoma
In development for (1)
- Neoplasm Phase 2