Sonavibart
Highest phase reached
Phase 2
Drug type
Antibody
- Listing at source
- Listed
- Highest phase reached
- Phase 2
- Drug type
- Antibody
- Drug name
- Sonavibart
- h gamma1 heavy chain homo sapiens 1 458 vh homo sapiens ighv6 1 01 95 0 ighd ighj3 02 93 8 cdr imgt 10 9 18 26 35 53 61 100 117 1 128 homo sapiens ighg1 03 g1m3 ng1m1 ch1 r120 ch3 e12 m14 g1v24 ch3 l107 s114 ch1 r120 225 129 226 hinge 1 15 227 241 ch2 242 351 ch3 e12 367 m14 369 m107 l 439 n114 s 445 352 456 chs 457 458 129 458 231 210 disulfide with l kappa light chain homo sapiens 1 210 v kappa homo sapiens igkv1 39 01 91 4 igkj1 01 100 cdr imgt 6 3 5 27 32 50 52 89 93 1 103 homo sapiens igkc 01 100 km3 a45 1 149 v101 187 104 210 dimer 237 237 240 240 bisdisulfide produced in chinese hamster ovary cho cells cell line cho k1 glycoform alfa
- H-gamma1 heavy chain Homo sapiens (1-458) [VH (Homo sapiens IGHV6-1*01 (95.0%) -(IGHD) -IGHJ3*02 (93.8%), CDR-IMGT [10.9.18] (26-35.53-61.100-117)) (1-128) -Homo sapiens IGHG1*03, G1m3, nG1m1 CH1 R120, CH3 E12, M14, G1v24 CH3 L107, S114 (CH1 R120 (225) (129-226), hinge 1-15 (227-241), CH2 (242-351), CH3 E12 (367), M14 (369), M107>L (439), N114>S (445) (352-456), CHS (457-458)) (129-458)], (231-210')-disulfide with L-kappa light chain Homo sapiens (1'-210') [V-KAPPA (Homo sapiens IGKV1-39*01 (91.4%) -IGKJ1*01 (100%), CDR-IMGT [6.3.5] (27'-32'.50'-52'.89'-93')) (1'-103') -Homo sapiens IGKC*01 (100%), Km3 A45.1 (149'), V101 (187') (104'-210')]; dimer (237-237'':240-240'')-bisdisulfide, produced in Chinese hamster ovary (CHO) cells, cell line CHO-K1, glycoform alfa
- Immunoglobulin G1 [439-leucine,445-serine], anti-(influenza A virus hemagglutinin) (human monoclonal VIR-2482 γ1-chain), disulfide with human monoclonal VIR-2482 κ-chain, dimer
- immunoglobulin g1 439 leucine 445 serine anti influenza a virus hemagglutinin human monoclonal vir 2482 γ1 chain disulfide with human monoclonal vir 2482 κ chain dimer
- immunoglobulin g1 kappa anti influenza a virus hemagglutinin ha homo sapiens monoclonal antibody sonavibart
- immunoglobulin G1-kappa, anti-[influenza A virus hemagglutinin HA], Homo sapiens monoclonal antibody (sonavibart)
- sonavibart
- Sonavibart
- sonavibart [INN]
- SONAVIBART [USAN]
- sonavibart inn
- sonavibart usan
- vir 2482
- Vir-2482
- VIR-2482
- VIR-2482 (1200 mg)
- VIR-2482 (450 mg)
- vir2482
- VIR2482
- CAS registry numbers
- 2769699-23-0
- ChEMBL ID
- CHEMBL6068464
- FDA ingredient codes (UNII)
- V7MT9HQR2Q
- First in class
- No
- Orphan designation
- No
- Drug name stem
- -bart
- Condition
- Virus Diseases
- Highest recorded phase
- 2
- Condition identifier
- EFO:0000763
- Subject identifier
- D014777
- Condition
- Influenza, Human
- Highest recorded phase
- 1
- Condition identifier
- EFO:0007328
- Subject identifier
- D007251
- Condition identifier
- EFO_0000763
- Condition identifier
- EFO_0007328
- Highest recorded phase
- 2
- Condition identifier
- MONDO_0005108
- Condition identifier
- MONDO_0005812
- Prodrug
- No
- Chirality
- Single enantiomer
- Inorganic
- No
- Natural product
- No
- Component
- Heavy chain
- Type
- Protein
- Sequence
- QVQLQQSGPGLVKPSQTLSLTCAISGDSVSSYNAVWNWIRQSPSRGLEWLGRTYYRSGWYNDYAESVKSRITINPDTSKNQFSLQLNSVTPEDTAVYYCARSGHITVFGVNVDAFDMWGQGTMVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVLHEALHSHYTQKSLSLSPGK
- Component
- Glycosylation sites (N)
- Sequence
- 308 $ 308''
- Component
- Disulfide bridges
- Sequence
- 22-99 $ 22''-99'' $ 23'-88' $ 23'''-88''' $ 130'-190' $ 130'''-190''' $ 155-211 $ 155''-211'' $ 231-210' $ 231''-210''' $ 237-237'' $ 240-240'' $ 272-332 $ 272''-332'' $ 378-436 $ 378''-436''
- Component
- Light chain
- Type
- Protein
- Sequence
- DIQMTQSPSSLSASVGDRVTITCRTSQSLSSYTHWYQQKPGKAPKLLIYAASSRGSGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQSRTFGQGTKVEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC
Related records
Trials (11)
- A Notch Signalling Pathway Inhibitor for Patients With Advanced Breast Cancer (0752-014)
- A Phase 2 Study to Evaluate the Efficacy and Safety of VIR-2482 for the Prevention of Illness Due to Influenza A
- A Study of H3B-6545 in Combination With Palbociclib in Women With Advanced or Metastatic Estrogen Receptor-Positive Human Epidermal Growth Factor Receptor-2 (HER2)-Negative Breast Cancer
- A Study of KF-0210 in Advanced Solid Tumors Patients
- AMBER-HFpEF: Assessment of CK-4021586 in a Multi-Center, Blinded Evaluation of Safety and Tolerability Results in HFpEF
- Evaluation of 611 in Chinese Adults With Moderate to Severe Chronic Obstructive Pulmonary Disease
- Relative Bioavailability Study of HU6
- Safety, Tolerability, Pharmacokinetics and Protective Efficacy of MAM01 in Healthy Adults
- Single Ascending Oral Dose Study to Investigate the Effects of OCT461201 in Healthy Volunteers
- Study of VIR-2482 in Healthy Volunteers
- Study to Evaluate the Efficacy, Safety, and Tolerability of Efzofitimod in Patients With Systemic Sclerosis (SSc)-Related Interstitial Lung Disease (ILD) (SSc-ILD)
In development for (2)
- Influenza Phase 1
- Viral infectious disease Phase 2