Rocatinlimab
Highest phase reached
Phase 3
Drug type
Antibody
- Listing at source
- Listed
- Highest phase reached
- Phase 3
- Drug type
- Antibody
- Drug name
- Rocatinlimab
- amg 451
- AMG 451
- AMG-451
- amg451
- AMG451
- immunoglobulin g1 anti human cd134 antigen human monoclonal khk4083 γ1 chain disulfide with human monoclonal khk4083 κ chain dimer
- immunoglobulin g1 kappa anti homo sapiens tnfrsf4 tumor necrosis factor receptor tnfr superfamily member 4 ox40 cd134 homo sapiens monoclonal antibody gamma1 heavy chain homo sapiens 1 447 vh homo sapiens ighv2 5 02 94 0 ighd ighj1 01 100 cdr imgt 10 7 9 26 35 53 59 98 106 1 117 homo sapiens ighg1 01 100 g1m17 1 ch1 k120 214 118 215 hinge 1 15 216 230 ch2 231 340 ch3 d12 356 l14 358 341 445 chs 446 447 118 447 220 214 disulfide with kappa light chain homo sapiens 1 214 v kappa homo sapiens igkv3 20 01 98 9 igkj4 01 100 cdr imgt 7 3 8 27 33 51 53 90 97 1 107 homo sapiens igkc 01 100 km3 a45 1 153 v101 191 108 214 dimer 226 226 229 229 bisdisulfide produced in chinese hamster ovary cho cells glycoform alfa
- immunoglobulin G1-kappa, anti-[Homo sapiens TNFRSF4 (tumor necrosis factor receptor (TNFR) superfamily member 4, OX40, CD134)], Homo sapiens monoclonal antibody; gamma1 heavy chain Homo sapiens (1-447) [VH (Homo sapiens IGHV2-5*02 (94.0%) -(IGHD) - IGHJ1*01 (100%), CDR-IMGT [10.7.9] (26-35.53- 59.98-106)) (1-117) -Homo sapiens IGHG1*01 (100%), G1m17,1 (CH1 K120 (214) (118-215), hinge 1-15 (216-230), CH2 (231-340), CH3 D12 (356), L14 (358) (341-445), CHS (446-447)) (118-447)], (220-214')- disulfide with kappa light chain Homo sapiens (1'-214') [V-KAPPA (Homo sapiens IGKV3-20*01 (98.9%) - IGKJ4*01 (100%), CDR-IMGT [7.3.8] (27-33.51-53.90- 97)) (1'-107') -Homo sapiens IGKC*01 (100%), Km3 A45.1 (153), V101 (191) (108'-214')]; dimer (226- 226'':229-229'')-bisdisulfide, produced in Chinese hamster ovary (CHO) cells, glycoform alfa
- Immunoglobulin G1, anti-(human CD134 antigen) (human monoclonal KHK4083 γ1-chain), disulfide with human monoclonal KHK4083 κ-chain, dimer
- khk 4083
- Khk-4083
- KHK-4083
- khk4083
- Khk4083
- KHK4083
- klk4083
- KLK4083
- rocatinlimab
- Rocatinlimab
- rocatinlimab [INN]
- ROCATINLIMAB [USAN]
- Rocatinlimab [WHO-DD]
- rocatinlimab inn
- rocatinlimab usan
- rocatinlimab who dd
- CAS registry numbers
- 2431972-52-8
- ChEMBL ID
- CHEMBL4594567
- FDA ingredient codes (UNII)
- G770V925KP
- First in class
- No
- Orphan designation
- No
- Pharmacology name
- rocatinlimab
- Type
- Antibody
- Drug name stem
- -mab
- Mechanism
- Tumor necrosis factor receptor superfamily member 4 antagonist
- Action type
- Antagonist
- Target
- Tumor necrosis factor receptor superfamily member 4
- Protein identifier
- P43489
- Action
- Inhibition
- Action type
- Inhibitor
- Target
- OX40
- Gene symbol
- TNFRSF4
- Protein identifier
- P43489
Open Targets mechanisms
- Mechanism
- Tumor necrosis factor receptor superfamily member 4 antagonist
- Action type
- Antagonist
- Target
- Tumor necrosis factor receptor superfamily member 4
- Condition
- Dermatitis, Atopic
- Highest recorded phase
- 3
- Condition identifier
- EFO:0000274
- Subject identifier
- D003876
- Condition
- Colitis, Ulcerative
- Highest recorded phase
- 1
- Condition identifier
- EFO:0000729
- Subject identifier
- D003093
- Condition identifier
- EFO_0000274
- Highest recorded phase
- 3
- Condition identifier
- EFO_0000729
- Highest recorded phase
- 2
- Condition identifier
- MONDO_0004979
- Highest recorded phase
- 2
- Condition identifier
- MONDO_0004980
- Highest recorded phase
- 3
- Condition identifier
- MONDO_0005101
- Highest recorded phase
- 2
- Condition identifier
- MONDO_0026045
- Highest recorded phase
- 3
- NCT02985593
- NCT03703102
- NCT05398445
- NCT05633355
- NCT05651711
- NCT05704738
- NCT05724199
- NCT05882877
- NCT05891119
- NCT05899816
- NCT06214481
- NCT06438263
- Prodrug
- No
- Inorganic
- No
- Natural product
- No
- Component
- Glycosylation sites (N)
- Sequence
- 297 $ 297'
- Component
- Heavy chain
- Type
- Protein
- Sequence
- QITLKESGPTLVKPKQTLTLTCTFSGFSLSTSGMGVGWIRQPPGKALEWLAVIYWDDHQLYSPSLKSRLTITKDTSKNQVVLTMTNMDPVDTATYYCAHRRGAFQHWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
- Component
- Disulfide bridges
- Sequence
- 22-97 $ 22'-97' $ 23''-89'' $ 23'''-89''' $ 134''-194'' $ 134'''-194''' $ 144-200 $ 144'-200' $ 220'-214''' $ 220-214'' $ 226-226' $ 229-229' $ 261-321 $ 261'-321' $ 367-425 $ 367'-425'
- Component
- Light chain
- Type
- Protein
- Sequence
- EIVLTQSPGTLSLSPGERATLSCRASQSVSSSYLAWYQQKPGQAPRLLIYGASSRATGIPDRFSGSGSGTDFTLTISRLEPEDFAVYYCQQYDSSLTFGGGTKVEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC
Related records
Trials (18)
- A Phase 1 Study of KHK4083 in Healthy Volunteers and Subjects With Ulcerative Colitis
- A Phase 1 Study of KHK4083 in Subjects With Atopic Dermatitis
- A Phase 2, Dose Ranging Study Assessing Rocatinlimab in Moderate-to-severe Asthma
- A Phase 3, Placebo-controlled, Double-blind Study Assessing Rocatinlimab in Prurigo Nodularis
- A Study Assessing Rocatinlimab (AMG 451) Monotherapy in Moderate-to-severe Atopic Dermatitis (AD) (ROCKET-Horizon)
- A Study Assessing Rocatinlimab in Combination With Topical Corticosteroid and/or Topical Calcineurin Inhibitors in Adult Participants With Moderate-to-severe Atopic Dermatitis (AD)
- A Study Assessing Rocatinlimab on Vaccine Antibody Response in Moderate-to-severe Atopic Dermatitis (AD) (ROCKET - VOYAGER)
- A Study Evaluating Rocatinlimab in Moderate-to-severe Atopic Dermatitis (ROCKET-IGNITE)
- A Study to Assess Bioavailability of Rocatinlimab (AMG 451) Vial and Prefilled Syringe in Healthy Participants
- A Study to Assess Long-term Safety, Tolerability, and Efficacy of Rocatinlimab in Adult and Adolescent Participants With Moderate-to-severe Atopic Dermatitis (AD)
- A Study to Assess the Safety, Tolerability, and Efficacy of Rocatinlimab in Adolescent Participants With Moderate-to-severe Atopic Dermatitis (AD)
- A Study to Evaluate Bioavailability of Rocatinlimab Autoinjector and Vial in Healthy Participants
- A Study to Evaluate Rocatinlimab (AMG 451) in Adolescent Participants With Moderate-to-severe Atopic Dermatitis (AD)
- A Study to Evaluate Rocatinlimab (AMG 451) in Healthy Chinese Participants
- A Study With Self-administered Rocatinlimab in Adolescent and Adult Participants With Moderate-to-severe Atopic Dermatitis
- Study of a Monoclonal Antibody KHK4083 in Moderate Ulcerative Colitis
- Study of an Anti-OX40 Monoclonal Antibody (KHK4083) in Subjects With Moderate to Severe Atopic Dermatitis
- Study to Investigate the Effect of Rocatinlimab (AMG 451) on the Pharmacokinetics of Multiple Cytochrome P450 (CYP450) Substrates in Participants With Moderate to Severe Atopic Dermatitis
In development for (4)
- Asthma Phase 2
- Atopic eczema Phase 3
- Prurigo nodularis Phase 3
- Ulcerative colitis Phase 1
Targets (1)
- TNFRSF4 Tumor necrosis factor receptor superfamily member 4 antagonist