Rinvecalinase alfa
Highest phase reached
Phase 2
Drug type
Enzyme
- Listing at source
- Listed
- Highest phase reached
- Phase 2
- Drug type
- Enzyme
- Drug name
- Rinvecalinase alfa
- dm 199
- DM-199
- dm199
- DM199
- human kallikrein 1 tissue kallikrein klk1 ec 3 4 21 35 mature form engineered variant e 121 q a 164 v produced in chinese hamster ovary cho cells glycoform alfa kallikrein 1 analogue
- human kallikrein-1 (tissue kallikrein, KLK1, EC:3.4.21.35) mature form, engineered variant (E 121>Q, A 164>V) produced in Chinese hamster ovary (CHO) cells, glycoform alfa kallikrein-1 analogue
- rinvecalinasa alfa
- Rinvecalinasa alfa
- rinvecalinase alfa
- Rinvecalinase alfa
- rinvecalinase alfa [INN]
- RINVECALINASE ALFA [USAN]
- rinvecalinase alfa inn
- rinvecalinase alfa usan
- Tissue kallikrein (recombinant human clone DM199)
- tissue kallikrein recombinant human clone dm199
- CAS registry numbers
- 2419877-37-3
- ChEMBL ID
- CHEMBL5314769
- FDA ingredient codes (UNII)
- H6Y3CRX3LC
- First in class
- No
- Orphan designation
- No
- Drug name stem
- -ase
- Condition
- Renal Insufficiency, Chronic
- Highest recorded phase
- 1
- Condition identifier
- EFO:0003884
- Subject identifier
- D051436
- Condition
- Myocardial Ischemia
- Highest recorded phase
- 1
- Condition identifier
- EFO:1001375
- Subject identifier
- D017202
- Condition identifier
- EFO_0000401
- Condition identifier
- EFO_0000668
- Condition identifier
- EFO_0003884
- Condition identifier
- EFO_1001375
- Condition identifier
- HP_0001297
- Highest recorded phase
- 2
- Condition identifier
- HP_0002140
- Highest recorded phase
- 2
- Condition identifier
- HP_0002637
- Highest recorded phase
- 2
- Condition identifier
- MONDO_0002679
- Highest recorded phase
- 2
- Condition identifier
- MONDO_0005016
- Highest recorded phase
- 1
- Condition identifier
- MONDO_0005098
- Highest recorded phase
- 2
- Condition identifier
- MONDO_0005147
- Highest recorded phase
- 1
- Condition identifier
- MONDO_0005299
- Highest recorded phase
- 2
- Condition identifier
- MONDO_0005300
- Condition identifier
- MONDO_0024575
- Condition identifier
- MONDO_0024644
- Condition identifier
- MONDO_1060198
- Highest recorded phase
- 2
- Prodrug
- No
- Chirality
- Single enantiomer
- Inorganic
- No
- Natural product
- No
- Component
- Glycosylation sites (N)
- Sequence
- 78 $ 84 $ 141
- Component
- Sequence
- Type
- Protein
- Sequence
- IVGGWECEQHSQPWQAALYHFSTFQCGGILVHRQWVLTAAHCISDNYQLWLGRHNLFDDENTAQFVHVSESFPHPGFNMSLLENHTRQADEDYSHDLMLLRLTEPADTITDAVKVVELPTQEPEVGSTCLASGWGSIEPENFSFPDDLQCVDLKILPNDECKKVHVQKVTDFMLCVGHLEGGKDTCVGDSGGPLMCDGVLQGVTSWGYVPCGTPNKPSVAVRVLSYVKWIEDTIAENS
- Component
- Disulfide bridges
- Sequence
- 7-150 $ 7-186 $ 7-211 $ 26-42 $ 129-196 $ 150-186 $ 150-211 $ 161-175 $ 175-186 $ 186-211
Related records
Trials (7)
- A Study to Evaluate the Safety and Effectiveness of DM199 in Healthy Subjects and Type 2 Diabetes Patients
- An Open Label, Phase 1b, Ascending Dose Study of DM199
- DM199 for Pregnancy Complications
- Evaluation to Assess Safety and Tolerability of DM199 in Subjects With Acute Ischemic Stroke
- Multiple Doses of DM199 in Patients With Chronic Kidney Disease (REDUX)
- Study to Assess PK, Safety and Tolerability in Patients With DM and CKD
- Treatment of Acute Ischemic Stroke (ReMEDy2 Trial)
In development for (8)
- Brain ischemia Phase 2
- Cerebral infarction Phase 2
- Chronic kidney disease Phase 1
- Diabetic kidney disease Phase 1
- Ischemic stroke Phase 2
- Myocardial ischemia Phase 1
- Stroke disorder Phase 2
- Type 1 diabetes mellitus Phase 1
Other linked conditions (2)
- Preeclampsia
- Pregnancy disorder