Rinatabart
Highest phase reached
Phase 2
Drug type
Antibody
- Listing at source
- Listed
- Highest phase reached
- Phase 2
- Drug type
- Antibody
- Drug name
- Rinatabart
- 190335
- f131
- F131
- h gamma1 heavy chain homo sapiens 1 453 vh homo sapiens ighv3 30 03 96 9 ighd ighj4 01 92 9 l123 q 118 cdr imgt 8 8 16 26 33 51 58 97 112 1 123 homo sapiens ighg1 01 g1m17 1 ch1 k120 ch3 d12 l14 g1v14 ch2 a1 3 a1 2 ch1 k120 220 124 221 hinge 1 15 222 236 ch2 l1 3 a 240 l1 2 a 241 237 346 ch3 d12 362 l14 364 347 451 chs 452 453 124 453 226 214 disulfide with l kappa light chain homo sapiens 1 214 v kappa homo sapiens igkv1 12 01 93 7 igkj4 01 91 7 cdr imgt 6 3 9 27 32 50 52 89 97 1 107 homo sapiens igkc 01 100 km3 a45 1 153 v101 191 108 214 dimer 232 232 235 235 bisdisulfide produced in a cell line from chinese hamster ovary cho cells derived from the cell line cho k1 glycoform alfa antineoplastic
- H-gamma1 heavy chain Homo sapiens (1-453) [VH (Homo sapiens IGHV3-30*03 (96.9%) -(IGHD) -IGHJ4*01 (92.9%) L123>Q (118), CDR-IMGT [8.8.16] (26-33.51-58.97-112)) (1-123) -Homo sapiens IGHG1*01, G1m17,1 CH1 K120, CH3 D12, L14, G1v14 CH2 A1.3, A1.2 (CH1 K120 (220) (124-221), hinge 1-15 (222-236), CH2 L1.3>A (240), L1.2>A (241) (237-346), CH3 D12 (362), L14 (364) (347-451), CHS (452-453)) (124-453)], (226-214')-disulfide with L-kappa light chain Homo sapiens (1'-214') [V-KAPPA (Homo sapiens IGKV1-12*01 (93.7%) -IGKJ4*01 (91.7%), CDR-IMGT [6.3.9] (27'-32'.50'-52'.89'-97')) (1'-107') -Homo sapiens IGKC*01 (100%), Km3 A45.1 (153'), V101 (191') (108'-214')]; dimer (232-232'':235-235'')-bisdisulfide, produced in a cell line from Chinese hamster ovary (CHO) cells, derived from the cell line CHO-K1, glycoform alfa antineoplastic
- Immunoglobulin G1 [240-alanine,241-alanine], anti-(human folate receptor α) (human monoclonal PRO1184 γ1-chain), disulfide with human monoclonal PRO1184 κ-chain, dimer
- immunoglobulin g1 240 alanine 241 alanine anti human folate receptor α human monoclonal pro1184 γ1 chain disulfide with human monoclonal pro1184 κ chain dimer
- immunoglobulin g1 kappa anti homo sapiens folr1 folate receptor 1 folate receptor alpha fr alpha adult folate binding protein fbp ovarian tumor associated antigen mov18 homo sapiens monoclonal antibody
- immunoglobulin G1-kappa, anti-[Homo sapiens FOLR1 (folate receptor 1, folate receptor alpha, FR-alpha, adult folate-binding protein, FBP, ovarian tumor-associated antigen MOv18)], Homo sapiens monoclonal antibody
- pro 1184 mab
- PRO-1184 MAB
- pro1184 mab
- PRO1184 mAb
- rinatabart
- Rinatabart
- rinatabart [INN]
- RINATABART [USAN]
- rinatabart inn
- rinatabart usan
- CAS registry numbers
- 2853518-94-0
- ChEMBL ID
- CHEMBL6068168
- FDA ingredient codes (UNII)
- WG3BRG4NE2
- First in class
- No
- Orphan designation
- No
- Pharmacology name
- rinatabart sesutecan
- Type
- Antibody
- Drug name stem
- -bart
Mechanisms of action
- Action type
- Binding
- Target
- folate receptor alpha
- Gene symbol
- folate receptor alpha
Investigated indications
- Condition
- Neoplasms
- Highest recorded phase
- 2
- Condition identifier
- EFO:0000616
- Subject identifier
- D009369
- Condition identifier
- EFO_0000616
- Condition identifier
- MONDO_0005070
- Prodrug
- No
- Chirality
- Single enantiomer
- Inorganic
- No
- Natural product
- No
- Component
- Heavy chain
- Type
- Protein
- Sequence
- EVQLLESGGGVVQPGRSLRLSCAASGFTFSSYGMHWVRQAPGKGLEWVAVISYDGSNKYYADSVKGRFTISRANSKNTLYLQMNSLRAEDTAVYYCARPRAYYGAYGSSFDYWGQGTQVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPEAAGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
- Component
- Light chain
- Type
- Protein
- Sequence
- EIVMTQSPSSVSASVGDRVAITCRASQGISSWLAWYQQKPGKAPKLLIYAASSLQSGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQSYSTPLTFGGGTKVDIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC
- Component
- Disulfide bridges
- Sequence
- 22-96 $ 22''-96'' $ 23'-88' $ 23'''-88''' $ 134'-194' $ 134'''-194''' $ 150-206 $ 150''-206'' $ 226-214' $ 226''-214''' $ 232-232'' $ 235-235'' $ 267-327 $ 267''-327'' $ 373-431 $ 373''-431''
- Component
- Glycosylation sites (N)
- Sequence
- 303 $ 303''
Related records
Trials (9)
- An Extension Study to Assess the Efficacy of Rina-S Compared to Treatment of Investigator's Choice in Participants With Platinum Resistant Ovarian Cancer in China
- Rinatabart Sesutecan (Rina-S, PRO1184, GEN1184) for Advanced Solid Tumors (GCT1184-01/ PRO1184-001)
- Study to Assess the Efficacy and Safety of Rina-S Compared to Treatment of Investigator's Choice in Participants With Endometrial Cancer
- Study to Assess the Efficacy and Safety of Rina-S in Participants With Advanced Gastrointestinal (GI) Cancers
- Study to Assess the Efficacy and Safety of Rina-S in Participants With Non-small Cell Lung Cancer
- Study to Assess the Efficacy and Safety of Rina-S Plus Standard of Care Compared to Standard of Care for Maintenance Treatment of Participants With Recurrent Platinum-sensitive Ovarian Cancer After Second-line (2L) Platinum-based Doublet Chemotherapy
- Study to Assess the Efficacy and Safety of Rina-S Plus Standard of Care Compared to Standard of Care Maintenance Treatment After First-line (1L) Platinum-based Chemotherapy in Participants With Ovarian Cancer
- Study to Assess the Efficacy and Safety of Rina-S With or Without Bevacizumab Compared to Investigator's Choice of Platinum-based Chemotherapy With or Without Bevacizumab as Second-line Treatment in Participants With Recurrent Platinum-sensitive Ovarian Cancer
- Study to Assess the Efficacy of Rina-S Compared to Treatment of Investigator's Choice in Participants With Platinum Resistant Ovarian Cancer
In development for (1)
- Neoplasm Phase 2