Rilvegostomig
Highest phase reached
Phase 3
Drug type
Antibody
- Listing at source
- Listed
- Highest phase reached
- Phase 3
- Drug type
- Antibody
- Drug name
- Rilvegostomig
- azd 2936
- Azd 2936
- AZD-2936
- azd2936
- Azd2936
- AZD2936
- immunoglobulin g1 kappa lambda anti homo sapiens pdcd1 programmed cell death 1 pd1 pd 1 cd279 and anti homo sapiens tigit t cell immunoreceptor with ig domain and itim v set ig member 9 vsig9 v set and transmembrane member 3 vstm3
- immunoglobulin g1 kappa lambda anti homo sapiens pdcd1 programmed cell death 1 pd1 pd 1 cd279 and anti homo sapiens tigit t cell immunoreceptor with ig domain and itim v set ig member 9 vsig9 v set and transmembrane member 3 vstm3 humanized and homo sapiens monoclonal antibody bispecific gamma1 heavy chain anti pdcd1 1 452 vh humanized homo sapiens ighv3 48 01 92 9 ighd ighj4 01 93 3 l123 t 117 cdr imgt 8 8 15 26 33 51 58 97 111 1 122 homo sapiens ighg1 03 g1m3 ng1m1 g1v39 ch2 f1 3 e1 2 s116 g1v33 ch3 s22 a24 v86 hole ch1 r120 219 123 220 hinge 1 15 221 235 ch2 l1 3 f 239 l1 2 e 240 p116 s 336 236 345 ch3 y5 c 354 e12 361 m14 363 t22 s 371 l24 a 373 y86 v 412 346 450 chs 451 452 123 452 225 219 disulfide with kappa light chain anti pdcd1 1 219 v kappa humanized homo sapiens igkv3d 7 01 81 1 igkj2 02 100 cdr imgt 11 3 9 27 37 55 57 94 102 1 112 homo sapiens igkc 01 100 km3 a45 1 158 v101 196 113 219 gamma1 heavy chain anti tigit 1 451 homo sapiens vh homo sapiens ighv3 30 01 96 9 ighd ighj6 01 94 4 cdr imgt 8 8 14 26 33 51 58 97 110 1 121 homo sapiens ighg1 03 g1m3 ng1m1 g1v32 ch3 w22 knob ch1 f5 c 130 r120 218 122 219 hinge 1 15 c5 v 224 220 234 ch2 l1 3 f 238 l1 2 e 239 p116 s 335 235 344 ch3 s10 c 358 e12 360 m14 362 t22 w 370 345 449 chs 450 451 122 451 130 125 disulfide with lambda light chain anti tigit 1 219 homo sapiens v lambda homo sapiens iglv1 44 01 92 6 iglj7 01 90 f118 l 101 cdr imgt 8 3 11 26 33 51 53 90 100 1 110 homo sapiens iglc2 01 98 1 s10 c 125 c126 v 215 111 216 heterodimer 231 230 234 233 354 358 trisdisulfide produced in chinese hamster ovary cho cells cell line cho cat s glycoform alfa
- immunoglobulin G1-kappa/lambda, anti-[Homo sapiens PDCD1(programmed cell death 1, PD1, PD-1, CD279)] and anti-[Homo sapiens TIGIT (T-cell immunoreceptor with Ig domain and ITIM, V-set Ig member 9, VSIG9, V-set and transmembrane member 3, VSTM3)]
- immunoglobulin G1-kappa/lambda, anti-[Homo sapiens PDCD1(programmed cell death 1, PD1, PD-1, CD279)] and anti-[Homo sapiens TIGIT (T-cell immunoreceptor with Ig domain and ITIM, V-set Ig member 9, VSIG9, V-set and transmembrane member 3, VSTM3)], humanized and Homo sapiens monoclonal antibody, bispecific; gamma1 heavy chain anti-PDCD1 (1-452) [VH humanized (Homo sapiens IGHV3-48*01 (92.9%) -(IGHD) -IGHJ4*01 (93.3%) L123>T (117), CDR-IMGT [8.8.15] (26-33.51-58.97-111)) (1-122) -Homo sapiens IGHG1*03, G1m3, nG1m1, G1v39 CH2 F1.3, E1.2, S116, G1v33 CH3 S22, A24, V86 (hole) (CH1 R120 (219) (123-220), hinge 1-15 (221-235), CH2 L1.3>F (239), L1.2>E (240), P116>S (336) (236-345), CH3 Y5>C (354), E12 (361), M14 (363), T22>S (371), L24>A(373), Y86>V (412) (346-450), CHS (451-452)) (123-452)], (225-219')-disulfide with kappa light chain anti-PDCD1 (1'-219') [V-KAPPA humanized (Homo sapiens IGKV3D-7*01 (81.1%) -IGKJ2*02 (100%), CDR-IMGT [11.3.9] (27-37.55-57.94-102)) (1'-112') -Homo sapiens IGKC*01 (100%), Km3 A45.1 (158), V101 (196) (113'-219')]; gamma1 heavy chain anti-TIGIT (1''-451'') Homo sapiens [VH (Homo sapiens IGHV3-30*01 (96.9%) -(IGHD) -IGHJ6*01 (94.4%), CDR-IMGT [8.8.14] (26-33.51-58.97-110)) (1''-121'') -Homo sapiens IGHG1*03, G1m3, nG1m1, G1v32 CH3 W22 (knob) (CH1 F5>C (130), R120 (218) (122''-219''), hinge 1-15 C5>V (224) (220''-234''), CH2 L1.3>F (238), L1.2>E (239), P116>S (335) (235''-344''), CH3 S10>C (358), E12 (360), M14 (362), T22>W (370) (345''-449''), CHS (450''-451'')) (122''-451'')], (130''-125''')-disulfide with lambda light chain anti-TIGIT (1'''-219''') Homo sapiens [V-LAMBDA (Homo sapiens IGLV1-44*01 (92.6%) -IGLJ7*01 (90%) F118>L (101) , CDR-IMGT [8.3.11] (26-33.51-53.90-100)) (1'''-110''') -Homo sapiens IGLC2*01 (98.1%) S10>C (125), C126>V (215) (111'''-216''')]; heterodimer (231-230'':234-233'': 354-358'')-trisdisulfide, produced in Chinese hamster ovary (CHO) cells, cell line CHO-CAT-S, glycoform alfa
- IV Rilvegostomig
- rilvegostomig
- Rilvegostomig
- rilvegostomig [INN]
- RILVEGOSTOMIG [USAN]
- Rilvegostomig [WHO-DD]
- rilvegostomig inn
- rilvegostomig usan
- rilvegostomig who dd
- CAS registry numbers
- 2640305-01-5
- ChEMBL ID
- CHEMBL5314706
- FDA ingredient codes (UNII)
- YSL2GUT2Q8
- First in class
- No
- Orphan designation
- No
- Drug name stem
- -mig
- Condition
- Carcinoma, Squamous Cell
- Highest recorded phase
- 2
- Condition identifier
- EFO:0000181
- Subject identifier
- D002294
- Condition
- Carcinoma, Hepatocellular
- Highest recorded phase
- 2
- Condition identifier
- EFO:0000182
- Subject identifier
- D006528
- Condition
- Neoplasms
- Highest recorded phase
- 2
- Condition identifier
- EFO:0000616
- Subject identifier
- D009369
- Condition
- Carcinoma, Non-Small-Cell Lung
- Highest recorded phase
- 3
- Condition identifier
- EFO:0003060
- Subject identifier
- D002289
- Condition
- Stomach Neoplasms
- Highest recorded phase
- 2
- Condition identifier
- EFO:0003897
- Subject identifier
- D013274
- Condition
- Stomach Neoplasms
- Highest recorded phase
- 2
- Condition identifier
- MONDO:0001056
- Subject identifier
- D013274
- Condition
- Biliary Tract Neoplasms
- Highest recorded phase
- 3
- Condition identifier
- MONDO:0003060
- Subject identifier
- D001661
- Condition identifier
- EFO_0000616
- Condition identifier
- EFO_0003060
- Highest recorded phase
- 3
- Condition identifier
- EFO_0003863
- Highest recorded phase
- 2
- Condition identifier
- MONDO_0001056
- Highest recorded phase
- 2
- Condition identifier
- MONDO_0002447
- Highest recorded phase
- 2
- Condition identifier
- MONDO_0003060
- Highest recorded phase
- 3
- Condition identifier
- MONDO_0003210
- Highest recorded phase
- 2
- Condition identifier
- MONDO_0003219
- Highest recorded phase
- 3
- Condition identifier
- MONDO_0004992
- Highest recorded phase
- 2
- Condition identifier
- MONDO_0005028
- Highest recorded phase
- 3
- Condition identifier
- MONDO_0005036
- Highest recorded phase
- 3
- Condition identifier
- MONDO_0005070
- Highest recorded phase
- 1
- Condition identifier
- MONDO_0005140
- Highest recorded phase
- 2
- Condition identifier
- MONDO_0005233
- Highest recorded phase
- 3
- Condition identifier
- MONDO_0005575
- Highest recorded phase
- 2
- Condition identifier
- MONDO_0006003
- Highest recorded phase
- 2
- Condition identifier
- MONDO_0007256
- Highest recorded phase
- 3
- Condition identifier
- MONDO_0008170
- Highest recorded phase
- 2
- Condition identifier
- MONDO_0008315
- Highest recorded phase
- 2
- Condition identifier
- MONDO_0010150
- Highest recorded phase
- 2
- Condition identifier
- MONDO_0011962
- Highest recorded phase
- 3
- Condition identifier
- MONDO_0021085
- Highest recorded phase
- 2
- Condition identifier
- MONDO_0024331
- Highest recorded phase
- 2
- NCT03819465
- NCT04612751
- NCT04686305
- NCT04995523
- NCT06357533
- NCT04379596
- NCT05702229
- NCT04541108
- NCT05414032
- NCT06366451
- NCT05775159
- NCT06109779
- NCT06467357
- Prodrug
- No
- Chirality
- Single enantiomer
- Inorganic
- No
- Natural product
- No
- Component
- Glycosylation sites (N)
- Sequence
- 302 $ 301''
- Component
- Disulfide bridges
- Sequence
- 22'''-89''' $ 22-96 $ 22''-96'' $ 23'-93' $ 130''-125''' $ 138'''-197''' $ 139'-199' $ 148''-204'' $ 149-205 $ 225-219' $ 231-230'' $ 234-233'' $ 265''-325'' $ 266-326 $ 354-358'' $ 371''-429'' $ 372-430
- Component
- Light chain: anti-TIGITlambda(L''')
- Type
- Protein
- Sequence
- QSVLTQPPSASGTPGQRVTISCSGSSSNIGRRPVNWYQQLPGTAPKLLIYSQNQRPSGVPDRFSGSQSGTSASLAISGLQSEDEADYFCAVWDDIGRVLQLGGGTQLTVLGQPKAAPSVTLFPPCSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPTEVS
- Component
- Heavy chain: anti-TIGIT(H'')
- Type
- Protein
- Sequence
- QVQLVESGGGVVQPGRSLRLSCAASGFTFSSYAMHWVRQAPGKGLEWVAVISYAGEVKYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARDPLPLHYYGMDVWGQGTTVTVSSASTKGPSVCPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPKSVDKTHTCPPCPAPEFEGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPASIEKTISKAKGQPREPQVYTLPPCREEMTKNQVSLWCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
- Component
- Light chain: anti-PDCD1kappa(L'')
- Type
- Protein
- Sequence
- QIVLTQSPATLSLSPGERATLSCSASSKHTNLYWSRHMYWYQQKPGQAPRLLIYLTSNRATGIPARFSGSGSGTDFTLTISSLEPEDFAVYYCQQWSSNPFTFGQGTKLEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC
- Component
- Heavy chain: anti-PDCD1(H)
- Type
- Protein
- Sequence
- EVQLVESGGGLVQPGGSLRLSCAASGFTFSDYGMHWVRQAPGKGLEWVAYISSGSYTIYSADSVKGRFTISRDNAKNSLYLQMNSLRAEDTAVYYCARRAPNSFYEYYFDYWGQGTTVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPKSCDKTHTCPPCPAPEFEGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPASIEKTISKAKGQPREPQVCTLPPSREEMTKNQVSLSCAVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLVSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
Related records
Trials (36)
- A Global Phase III Study of Rilvegostomig or Pembrolizumab Monotherapy for First-Line Treatment of PD-L1-high Metastatic Non-small Cell Lung Cancer
- A Global Phase III Study of Rilvegostomig or Pembrolizumab Plus Chemotherapy for First-Line Treatment of Locally Advanced or Metastatic Non-Squamous NSCLC
- A Global Phase III Study of Rilvegostomig or Pembrolizumab Plus Chemotherapy for First-Line Treatment of Locally Advanced or Metastatic Squamous Non-small Cell Lung Cancer (NSCLC)
- A Phase I/IIa Study of AZD8205 Given Alone or Combined, in Participants With Advanced/Metastatic Solid Malignancies
- A Phase Ⅲ Study of Rilvegostomig in Combination With Fluoropyrimidine and Trastuzumab Deruxtecan as the First-line Treatment for HER2-positive Gastric Cancer
- A Phase III, Randomised Study of Adjuvant Dato-DXd in Combination With Rilvegostomig or Rilvegostomig Monotherapy Versus Standard of Care, Following Complete Tumour Resection, in Participants With Stage I Adenocarcinoma NSCLC Who Are ctDNA-positive or Have High-risk Pathological Features
- A Platform Study in Non-Small Cell Lung Cancer (NSCLC)
- A Study of AZD2936 Anti-TIGIT/Anti-PD-1 Bispecific Antibody in Participants With Advanced or Metastatic NSCLC
- A Study of Novel Agents or Combinations as Perioperative Treatment in Participants With Locally Advanced Resectable Gastroesophageal Adenocarcinoma
- A Study of Novel Anti-cancer Agents in Patients With Previously Untreated NSCLC
- A Study of Novel Combinations in Non-Small Cell Lung Cancer (NSCLC)
- A Study of Rilvegostomig or Durvalumab Plus Chemotherapy for First-Line Treatment of Biliary Tract Cancer (ARTEMIDE-Biliary02)
- A Study to Investigate Safety of AZD6750 in Adult Participants With Select Advanced or Metastatic Solid Tumors
- A Study to Investigate the Pharmacokinetics and Safety of Subcutaneous Rilvegostomig in Adult Participants With Advanced Solid Tumors Previously Treated With Standard of Care Therapy
- An Open-label Study to Investigate the Efficacy and Safety of Dato-DXd + Rilvegostomig vs SoC in Adult Participants With High-risk MIUC
- DESTINY-Endometrial01: A Phase III Study of Trastuzumab Deruxtecan Plus Rilvegostomig or Pembrolizumab as First-Line Treatment of HER2-Expressing (IHC 3+/2+), Mismatch Repair Proficient (pMMR) Endometrial Cancer
- Gemcitabine/Cisplatin/Nab-Paclitaxel and Rilvegostomig in Resectable iCCA
- I-SPY TRIAL: Neoadjuvant and Personalized Adaptive Novel Agents to Treat Breast Cancer
- Local and Systemic Immune Modulation by Rilvegostomig (AZD2936) in the Treatment of Advanced Gastric Cancer (RILVE Project)
- Molecular Residual Disease Interception in Locoregionally-Advanced High Risk HPV+ and HPV- HNSCC
In development for (7)
- Biliary tract cancer Phase 3
- Gastric cancer Phase 2
- Gastric neoplasm Phase 2
- Head and neck squamous cell carcinoma Phase 2
- Hepatocellular carcinoma Phase 2
- Neoplasm Phase 2
- Non-small cell lung carcinoma Phase 3