Povetacicept
Highest phase reached
Phase 2
Drug type
Protein
- Listing at source
- Listed
- Highest phase reached
- Phase 2
- Drug type
- Protein
- Drug name
- Povetacicept
- variant tnf receptor domain
- Variant tnf receptor domain
- 68 110 tumor necrosis factor receptor superfamily protein tnfrsf13b 77 glutamic acid 78 tyrosine 102 aspartic acid human fusion with peptide linker gsggggs fusion with immunoglobulin g1 5 serine 19 alanine 20 glutamic acid 22 alanine de c terminal lysine human γ1 chain c region c terminal fragment dimer
- 68-110-Tumor necrosis factor receptor superfamily protein TNFRSF13B [77-glutamic acid,78-tyrosine,102-aspartic acid] (human) fusion with peptide linker (GSGGGGS) fusion with immunoglobulin G1 [5-serine,19-alanine,20-glutamic acid,22-alanine,de-C-terminal-lysine] (human γ1-chain C-region C-terminal fragment), dimer
- alpn 303
- alpn 303 dual baff april fc fusion antagonist
- ALPN-303
- ALPN-303 (DUAL BAFF/APRIL Fc Fusion Antagonist)
- human TACI (transmembrane activator and CAML interactor, tumor necrosis factor receptor superfamily member 13B, TNFRSF13B, CD267) receptor domain 68-110 fragment (K77>E10, F78>Y11, Y102>D35)-mutant (1-43), fused via a GSG4S peptide linker (44-50) with 232 C-terminal residues of a mutated human immunoglobulin G1 gamma1 heavy chain (51-281) [Homo sapiens IGHG1*01, hinge C55>S (51-65), CH2 L69>A, L70>E, G72>A (66-175), CH3 (176-280), CHS K282>del (281)], (61-61':64-64')-bisdisulfide dimer, produced in Chinese hamster ovary (CHO) cells, cell line CHO-K1 GS-, glycoform alfa
- human taci transmembrane activator and caml interactor tumor necrosis factor receptor superfamily member 13b tnfrsf13b cd267 receptor domain 68 110 fragment k77 e10 f78 y11 y102 d35 mutant 1 43 fused via a gsg4s peptide linker 44 50 with 232 c terminal residues of a mutated human immunoglobulin g1 gamma1 heavy chain 51 281 homo sapiens ighg1 01 hinge c55 s 51 65 ch2 l69 a l70 e g72 a 66 175 ch3 176 280 chs k282 del 281 61 61 64 64 bisdisulfide dimer produced in chinese hamster ovary cho cells cell line cho k1 gs glycoform alfa
- povetacicept
- Povetacicept
- povetacicept [INN]
- POVETACICEPT [USAN]
- Povetacicept [WHO-DD]
- povetacicept inn
- povetacicept usan
- povetacicept who dd
- CAS registry numbers
- 2490217-42-8
- ChEMBL ID
- CHEMBL5095306
- FDA ingredient codes (UNII)
- EN2U82XV65
- Patents
- 0
- Designations
- 2
- First in class
- No
- Fast track
- No
- Breakthrough designation
- No
- Orphan designation
- No
- Priority review
- No
- Orphan exclusivity
- No
- Accelerated approval
- No
- Pharmacology name
- povetacicept
- Type
- Peptide
- Drug name stem
- -cept
- Action
- Binding
- Action type
- Binding
- Target
- APRIL
- Gene symbol
- APRIL
- Median affinity
- 12
- Affinity units
- pKd
- Action
- Binding
- Action type
- Binding
- Target
- BAFF
- Gene symbol
- BAFF
- Median affinity
- 10.23
- Affinity units
- pKd
- Condition
- Purpura, Thrombocytopenic, Idiopathic
- Highest recorded phase
- 1
- Condition identifier
- EFO:0007160
- Subject identifier
- D016553
- Condition
- Anemia, Hemolytic, Autoimmune
- Highest recorded phase
- 1
- Condition identifier
- MONDO:0018922
- Subject identifier
- D000744
- Condition
- Inflammation
- Highest recorded phase
- 1
- Condition identifier
- MP:0001845
- Subject identifier
- D007249
- Condition identifier
- EFO_0004194
- Highest recorded phase
- 3
- Condition identifier
- EFO_0007160
- Condition identifier
- MONDO_0005342
- Highest recorded phase
- 3
- Condition identifier
- MONDO_0005556
- Highest recorded phase
- 1
- Condition identifier
- MONDO_0008558
- Highest recorded phase
- 1
- Condition identifier
- MONDO_0015492
- Highest recorded phase
- 1
- Condition identifier
- MONDO_0018922
- Condition identifier
- MONDO_0018922
- Highest recorded phase
- 1
- Condition identifier
- MONDO_0020108
- Highest recorded phase
- 1
- Condition identifier
- MP_0001845
Trial references
- NCT05757570
- Prodrug
- No
- Chirality
- Single enantiomer
- Inorganic
- No
- Natural product
- No
- Component
- Glycosylation sites (N)
- Sequence
- 132 $ 132'
- Component
- Sequence
- Type
- Protein
- Sequence
- SLSCRKEQGEYYDHLLRDCISCASICGQHPKQCADFCENKLRSGSGGGGSEPKSSDKTHTCPPCPAPEAEGAPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPOVYTLPPSRDELTKNOVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPG
- Component
- Disulfide bridges
- Sequence
- 4-19 $ 4'-19' $ 22-33 $ 22'-33' $ 26-37 $ 26'-37' $ 61-61' $ 64-64' $ 96-156 $ 96'-156' $ 202-260 $ 202'-260'
Related records
Trials (9)
- A Phase 2 Study to Evaluate Povetacicept in Adults With Generalized Myasthenia Gravis
- A Phase 3 Open-Label Study of Long-term Treatment With Povetacicept in Adults With Immunoglobulin A Nephropathy
- A Phase 3b Study of Participant Experience on Povetacicept Administered Via Autoinjector as Compared to Sibeprenlimab Administered Via Prefilled Syringe
- A Study of ALPN-303 in Adult Healthy Volunteers
- A Study to Evaluate the Relative Bioavailability of Povetacicept Formulations and Bioequivalence of Povetacicept Presentations
- An Open-label Study of Povetacicept in Autoantibody-Associated Glomerular Diseases
- An Open-label Study of Povetacicept in Participants With Autoimmune Cytopenias (RUBY-4)
- Evaluation of Efficacy of Povetacicept in Adults With Immunoglobulin A Nephropathy (IgAN)
- Evaluation of Efficacy, Safety, and Tolerability of Povetacicept in Participants With Primary Membranous Nephropathy (pMN)
In development for (6)
- Anti-neutrophil cytoplasmic antibody-associated vasculitis Phase 1
- Autoimmune hemolytic anemia Phase 1
- Autoimmune thrombocytopenic purpura Phase 1
- Cold agglutinin disease Phase 1
- IgA glomerulonephritis Phase 3
- Lupus nephritis Phase 1