Pasritamig
Highest phase reached
Phase 2
Drug type
Antibody
- Listing at source
- Listed
- Highest phase reached
- Phase 2
- Drug type
- Antibody
- Drug name
- Pasritamig
- h gamma1 heavy chain homo sapiens anti klk2 1 455 vh homo sapiens ighv4 59 01 100 ighd ighj6 01 94 4 cdr imgt 8 7 19 26 33 51 57 96 114 1 125 homo sapiens ighg1 03v g1m3 g1m17 ng1m1 ch1 k120 ch3 e12 m14 g1v14 67 ch2 a1 3 a1 2 s27 g1v68 ch3 v6 l22 l79 w81 ch1 r120 k 222 126 223 hinge 1 15 224 238 ch2 l1 3 a 242 l1 2 a 243 d27 s 273 239 348 ch3 t6 v 358 e12 364 m14 366 t22 l 374 k79 l 400 t81 w 402 349 453 chs 454 455 126 455 228 214 disulfide with l kappa light chain homo sapiens anti klk2 1 214 v kappa homo sapiens igkv1 9 01 97 9 igkj4 01 100 cdr imgt 6 3 9 27 32 50 52 89 97 1 107 homo sapiens igkc 01 100 km3 a45 1 v101 c kappa a45 1 153 v101 191 108 214 scfvkh g1 h ch2 ch3 heavy chain humanized anti cd3e 1 475 v kappa homo sapiens igkv1 39 01 86 3 igkj2 01 100 cdr imgt 6 3 9 27 32 50 52 89 97 1 107 20 mer ggsegkssgsgseskstggs linker 108 127 vh homo sapiens ighv3 21 01 89 8 ighd ighj4 01 100 cdr imgt 8 8 9 153 160 178 185 224 232 128 243 homo sapiens ighg1 03 h ch2 ch3 ng1m1 ch3 e12 m14 g1v14 67 ch2 a1 3 a1 2 s27 g1v37 h s5 g1v69 ch3 v6 y7 a85 1 v86 hinge 1 15 c5 s 248 244 258 ch2 l1 3 a 262 l1 2 a 263 d27 s 293 259 368 ch3 t6 v 378 l7 y 379 e12 384 m14 386 f85 1 a 433 y86 v 435 369 473 chs 474 475 244 475 dimer 234 254 237 257 bisdisulfide produced in chinese hamster ovary cho cells glycoform alfa
- H-gamma1 heavy chain Homo sapiens, anti-KLK2 (1-455) [VH (Homo sapiens IGHV4-59*01 (100%) -(IGHD) -IGHJ6*01 (94.4%), CDR-IMGT [8.7.19] (26-33.51-57.96-114)) (1-125) -Homo sapiens IGHG1*03v G1m3>G1m17, nG1m1 CH1 K120, CH3 E12, M14, G1v14-67 CH2 A1.3, A1.2, S27, G1v68 CH3 V6, L22, L79, W81 (CH1 R120>K (222) (126-223), hinge 1-15 (224-238), CH2 L1.3>A (242), L1.2>A (243), D27>S (273) (239-348), CH3 T6>V (358), E12 (364), M14 (366), T22>L (374), K79>L (400), T81>W (402) (349-453), CHS (454-455)) (126-455)], (228-214')-disulfide with L-kappa light chain Homo sapiens, anti-KLK2 (1'-214') [V-KAPPA (Homo sapiens IGKV1-9*01 (97.9%) -IGKJ4*01 (100%), CDR-IMGT [6.3.9] (27'-32'.50'-52'.89'-97')) (1'-107') -Homo sapiens IGKC*01 (100%) Km3 A45.1, V101 (C-KAPPA A45.1 (153'), V101 (191')) (108'-214')]; scFvkh-G1(h-CH2-CH3) heavy chain humanized, anti-CD3E (1''-475'') [V-KAPPA (Homo sapiens IGKV1-39*01 (86.3%) -IGKJ2*01 (100%), CDR-IMGT [6.3.9] (27''-32''.50''-52''.89''-97'')) (1''-107'') -20-mer (GGSEGKSSGSGSESKSTGGS) linker (108''-127'') -VH (Homo sapiens IGHV3-21*01 (89.8%) -(IGHD) -IGHJ4*01 (100%), CDR-IMGT [8.8.9] (153''-160''.178''-185''.224''-232'')) (128''-243'') -Homo sapiens IGHG1*03 h-CH2-CH3, nG1m1 CH3 E12, M14, G1v14-67 CH2 A1.3, A1.2, S27, G1v37 h S5, G1v69 CH3 V6, Y7, A85.1, V86 (hinge 1-15 C5>S (248'') (244''-258''), CH2 L1.3>A (262''), L1.2>A (263''), D27>S (293'') (259''-368''), CH3 T6>V (378''), L7>Y (379''), E12 (384''), M14 (386''), F85.1>A (433''), Y86>V (435'') (369''-473''), CHS (474''-475'')) (244''-475'')]; dimer (234-254'': 237-257'')-bisdisulfide, produced in Chinese hamster ovary (CHO) cells, glycoform alfa
- immunoglobulin (H-gamma1_L-kappa)_scFvkh-G1(h-CH2-CH3), anti-[Homo sapiens KLK2 (kallikrein-2, kallikrein related peptidase 2, kallikrein 2 prostatic) and anti-[Homo sapiens CD3E (CD3 epsilon, Leu-4)], Homo sapiens and humanized monoclonal antibody, bispecific, bivalent
- immunoglobulin g1 bispecific anti human cd3 antigen ε chain human mus musculus monoclonal klcb245 single chain variable region fragment vl peptide linker synthetic 20 amino acid vh fusion protein with immunoglobulin g1 5 serine 19 alanine 20 alanine 50 serine 81 tyrosine 135 valine 136 tyrosine 190 alanine 192 valine human allotype g1m 17 γ1 chain hinge ch2 ch3 domain fragment 254 234 257 237 bis disulfide with immunoglobulin g1 242 alanine 243 alanine 273 serine 358 valine 374 leucine 400 leucine 402 tryptophan anti human kallikrein 2 human mus musculus monoclonal klcb245 allotype g1m 17 γ1 chain disulfide with human mus musculus monoclonal klcb245 κ chain
- Immunoglobulin G1, bispecific, anti-(human CD3 antigen ε-chain) (human-Mus musculus monoclonal KLCB245 single-chain variable region fragment VL-(peptide linker (synthetic 20-amino acid))-VH) fusion protein with immunoglobulin G1 [5-serine,19-alanine,20-alanine,50-serine,81-tyrosine,135-valine,136-tyrosine,190-alanine,192-valine] (human allotype G1m(17) γ1-chain hinge-CH2-CH3 domain fragment), (254→234′),(257→237′)-bis(disulfide) with immunoglobulin G1 [242-alanine,243-alanine,273-serine,358-valine,374-leucine,400-leucine,402-tryptophan] anti-(human kallikrein 2) (human-Mus musculus monoclonal KLCB245 allotype G1m(17) γ1-chain) disulfide with human-Mus musculus monoclonal KLCB245 κ-chain
- immunoglobulin h gamma1 l kappa scfvkh g1 h ch2 ch3 anti homo sapiens klk2 kallikrein 2 kallikrein related peptidase 2 kallikrein 2 prostatic and anti homo sapiens cd3e cd3 epsilon leu 4 homo sapiens and humanized monoclonal antibody bispecific bivalent
- jnj 78278343
- Jnj-78278343
- JNJ-78278343
- klcb 245
- KLCB-245
- klcb245
- KLCB245
- pasritamig
- Pasritamig
- pasritamig [INN]
- PASRITAMIG [USAN]
- Pasritamig [WHO-DD]
- pasritamig inn
- pasritamig usan
- pasritamig who dd
- CAS registry numbers
- 2921676-04-0
- ChEMBL ID
- CHEMBL6068280
- FDA ingredient codes (UNII)
- NDM64RSJ42
- First in class
- No
- Orphan designation
- No
- Pharmacology name
- pasritamig
- Type
- Antibody
- Drug name stem
- -mig
Mechanisms of action
- Action
- Binding
- Action type
- Binding
- Target
- kallikrein related peptidase 2
- Gene symbol
- KLK2
- Protein identifier
- P20151
- Condition
- Neoplasms
- Highest recorded phase
- 2
- Condition identifier
- EFO:0000616
- Subject identifier
- D009369
- Condition
- Prostatic Neoplasms
- Highest recorded phase
- 1
- Condition identifier
- EFO:0000673
- Subject identifier
- D011471
- Condition
- Prostatic Neoplasms
- Highest recorded phase
- 1
- Condition identifier
- EFO:0001663
- Subject identifier
- D011471
- Condition
- Prostatic Neoplasms, Castration-Resistant
- Highest recorded phase
- 1
- Condition identifier
- MONDO:0008315
- Subject identifier
- D064129
- Condition identifier
- EFO_0000616
- Condition identifier
- EFO_0001663
- Highest recorded phase
- 1
- Condition identifier
- MONDO_0005070
- Condition identifier
- MONDO_0008315
- Highest recorded phase
- 1
- Condition identifier
- MONDO_0008315
- Highest recorded phase
- 3
- Condition identifier
- MONDO_0021259
- Highest recorded phase
- 1
- NCT04898634
- NCT05818683
- NCT06095089
- Prodrug
- No
- Chirality
- Single enantiomer
- Inorganic
- No
- Natural product
- No
- Component
- Glycosylation sites (N)
- Sequence
- 305 $ 325''
- Component
- Light chain: L-kappa anti-KLK2 (L')
- Type
- Protein
- Sequence
- DIQMTQSPSFLSASVGDRVTITCRASQGISSYLAWYQQKPGKAPKFLIYAASTLQSGVPSRFSGSGSGTEFTLTISSLQPEDFATYYCQQLNSYPLTFGGGTKVEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC
- Component
- Heavy chain: H-gamma1 anti-KLK2 (H)
- Type
- Protein
- Sequence
- QVQLQESGPGLVKPSETLSLTCTVSGGSISSYYWSWIRQPPGKGLEWIGYIYYSGSTNYNPSLKSRVTISVDTSKNQFSLKLSSVTAADTAVYYCAGTTIFGVVTPNFYYGMDVWGQGTTVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPEAAGGPSVFLFPPKPKDTLMISRTPEVTCVVVSVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYVLPPSREEMTKNQVSLLCLVKGFYPSDIAVEWESNGQPENNYLTWPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
- Component
- Disulfide bridges
- Sequence
- 22-95 $ 23'-88' $ 23''-88'' $ 134'-194' $ 149''-223'' $ 152-208 $ 228-214'$ 234-254'' $ 237-257'' $ 269-329 $ 289''-349'' $ 375-433 $ 395''-453''
- Component
- Heavy chain: scFvkh anti-CD3E (H'')
- Type
- Protein
- Sequence
- DIQMTQSPSSLSASVGDRVTITCRARQSIGTAIHWYQQKPGKAPKLLIKYASESISGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQSGSWPYTFGQGTKLEIKGGSEGKSSGSGSESKSTGGSEVQLVESGGGLVKPGGSLRLSCAASGFTFSRYNMNWVRQAPGKGLEWVSSISTSSNYIYYADSVKGRFTFSRDNAKNSLDLQMSGLRAEDTAIYYCTRGWGPFDYWGQGTLVTVSSEPKSSDKTHTCPPCPAPEAAGGPSVFLFPPKPKDTLMISRTPEVTCVVVSVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYVYPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFALVSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
Related records
Trials (8)
- A Study of JNJ-69086420, an Actinium-225-Labeled Antibody Targeting Human Kallikrein-2 (hK2) for Advanced Prostate Cancer
- A Study of JNJ-78278343 in Combination With JNJ-95298177 for Treatment of Prostate Cancer
- A Study of JNJ-78278343, a T-Cell-Redirecting Agent Targeting Human Kallikrein 2 (KLK2), for Advanced Prostate Cancer
- A Study of JNJ-87189401 Combined With JNJ-78278343 for Advanced Prostate Cancer
- A Study of Pasritamig (JNJ-78278343) in Combination With JNJ-86974680 for Treatment of Prostate Cancer
- A Study of Pasritamig (JNJ-78278343) in Combination With Other Agents for Metastatic Prostate Cancer
- A Study of Pasritamig With Docetaxel Versus Docetaxel in Participants With Metastatic Castration-Resistant Prostate Cancer
- A Study of Pasritamig With or Without JNJ-87189401 Versus Placebo for Late Line Metastatic Castration-resistant Prostate Cancer (mCRPC)
In development for (5)
- Neoplasm Phase 2
- Prostate adenocarcinoma Phase 1
- Prostate cancer Phase 1
- Prostate carcinoma Phase 1
- Prostate neoplasm Phase 1