Olatorepatide
Highest phase reached
Phase 2
Drug type
Protein
- Listing at source
- Listed
- Highest phase reached
- Phase 2
- Drug type
- Protein
- Drug name
- Olatorepatide
- l lysinamide l tyrosyl 2 methylalanyl l α glutamylglycyl l threonyl l phenylalanyl l threonyl l seryl l α aspartyl l tyrosyl l seryl l isoleucyl l tyrosyl l leucyl l α glutamyl l lysyl l isoleucyl l alanyl l alanyl l glutaminyl l α glutamyl l phenylalanyl l valyl l asparaginyl l tryptophyl l leucyl l leucyl l alanylglycylglycyl l prolyl l seryl l serylglycyl l alanyl l prolyl l prolyl l prolyl l seryl n6 n 19 carboxy 1 oxononadecyl l γ glutamyl 2 2 2 aminoethoxy ethoxy acetyl 2 2 2 aminoethoxy ethoxy acetyl
- l tyrosyl 2 methylalanyl l α glutamylglycyl l threonyl lphenylalanyl l threonyl l seryl l α aspartyl l tyrosyl l seryl lisoleucyl l tyrosyl l leucyl l α glutamyl l lysyl l isoleucyl lalanyl l alanyl l glutaminyl l α glutamyl l phenylalanyl l valyl lasparaginyl l tryptophyl l leucyl l leucyl l alanylglycylglycyl lprolyl l seryl l serylglycyl l alanyl l prolyl l prolyl l prolyl lseryl n sup 6 sup 22s 22 42 dicarboxy 10 19 24 trioxo 3 6 12 15 tetraoxa 9 18 23 triazadotetracontan 1 oyl l lysinamide
- L-Lysinamide, L-tyrosyl-2-methylalanyl-L-α-glutamylglycyl-L-threonyl-L-phenylalanyl-L-threonyl-L-seryl-L-α-aspartyl-L-tyrosyl-L-seryl-L-isoleucyl-L-tyrosyl-L-leucyl-L-α-glutamyl-L-lysyl-L-isoleucyl-L-alanyl-L-alanyl-L-glutaminyl-L-α-glutamyl-L-phenylalanyl-L-valyl-L-asparaginyl-L-tryptophyl-L-leucyl-L-leucyl-L-alanylglycylglycyl-L-prolyl-L-seryl-L-serylglycyl-L-alanyl-L-prolyl-L-prolyl-L-prolyl-L-seryl-N6-[N-(19-carboxy-1-oxononadecyl)-L-γ-glutamyl-2-[2-(2-aminoethoxy)ethoxy]acetyl-2-[2-(2-aminoethoxy)ethoxy]acetyl]-
- L-tyrosyl-2-methylalanyl-L-α-glutamylglycyl-L-threonyl-Lphenylalanyl-L-threonyl-L-seryl-L-α-aspartyl-L-tyrosyl-L-seryl-Lisoleucyl-L-tyrosyl-L-leucyl-L-α-glutamyl-L-lysyl-L-isoleucyl-Lalanyl-L-alanyl-L-glutaminyl-L-α-glutamyl-L-phenylalanyl-L-valyl-Lasparaginyl-L-tryptophyl-L-leucyl-L-leucyl-L-alanylglycylglycyl-Lprolyl-L-seryl-L-serylglycyl-L-alanyl-L-prolyl-L-prolyl-L-prolyl-Lseryl-N<sup>6</sup>-[(22S)-22,42-dicarboxy-10,19,24-trioxo-3,6,12,15-tetraoxa-9,18,23-triazadotetracontan-1-oyl]-L-lysinamide
- olatorepatida
- Olatorepatida
- olatorepatide
- Olatorepatide
- olatorepatide [INN]
- olatorepatide inn
- CAS registry numbers
- 2675496-01-0
- ChEMBL ID
- CHEMBL6068153
- FDA ingredient codes (UNII)
- AB29LD7VUQ
- First in class
- No
- Orphan designation
- No
- Pharmacology name
- olatorepatide
- Type
- Peptide
- Drug name stem
- -tide
Investigated indications
- Condition
- Diabetes Mellitus
- Highest recorded phase
- 2
- Condition identifier
- EFO:0000400
- Subject identifier
- D003920
- Condition identifier
- EFO_0000400
- Condition identifier
- HP_0001513
- Highest recorded phase
- 2
- Condition identifier
- HP_0025502
- Highest recorded phase
- 2
- Condition identifier
- MONDO_0005015
- Prodrug
- No
- Chirality
- Single enantiomer
- Inorganic
- No
- Natural product
- No
Sequences
- Component
- Sequence
- Type
- Protein
- Sequence
- YXEGTFTSDYSIYLEKIAAQEFVNWLLAGGPSSGAPPPSK
Related records
Trials (2)
- Study of Olatorepatide in Adult Participants Living With Overweight or Obesity in the US
- Study of Olatorepatide in Adult Participants Living With Overweight or Obesity Without Diabetes
In development for (1)
- Diabetes mellitus Phase 2