Ocankitug
Highest phase reached
Phase 2
Drug type
Antibody
- Listing at source
- Listed
- Highest phase reached
- Phase 2
- Drug type
- Antibody
- Drug name
- Ocankitug
- cm 326
- CM-326
- cm326
- Cm326
- CM326
- CM326 injection
- CM326(formulation 1)
- CM326(formulation 2)
- h gamma1 heavy chain humanized 1 447 vh homo sapiens ighv1 46 01 87 8 ighd ighj4 01 93 3 cdr imgt 8 8 10 26 33 51 58 97 106 1 117 homo sapiens ighg1 03 100 g1m3 ng1m1 ch1 r120 ch3 e12 m14 ch1 r120 214 118 215 hinge 1 15 216 230 ch2 231 340 ch3 e12 356 m14 358 341 445 chs 446 447 118 447 220 214 disulfide with l kappa light chain humanized 1 214 v kappa homo sapiens igkv1 39 01 86 3 igkj1 01 100 cdr imgt 6 3 9 27 32 50 52 89 97 1 107 homo sapiens igkc 01 100 km3 a45 1 153 v101 191 108 214 dimer 226 226 229 229 bisdisulfide produced in chinese hamster ovary cho cells derived from the cell line cho k1 lacking the glutamine synthetase gs ko gene glycoform alfa
- H-gamma1 heavy chain humanized (1-447) [VH (Homo sapiens IGHV1-46*01 (87.8%) -(IGHD) -IGHJ4*01 (93.3%), CDR-IMGT [8.8.10] (26-33.51-58.97-106)) (1-117) -Homo sapiens IGHG1*03 (100%), G1m3, nG1m1 CH1 R120, CH3 E12, M14(CH1 R120 (214) (118-215), hinge 1-15 (216-230), CH2 (231-340), CH3 E12 (356), M14 (358) (341-445), CHS (446-447)) (118-447)], (220-214')-disulfide with L-kappa light chain humanized (1'-214') [V-KAPPA (Homo sapiens IGKV1-39*01 (86.3%) -IGKJ1*01 (100%), CDR-IMGT [6.3.9] (27'-32'.50'-52'.89'-97')) (1'-107') -Homo sapiens IGKC*01 (100%), Km3 A45.1 (153'), V101 (191') (108'-214')]; dimer (226-226'':229-229'')-bisdisulfide, produced in Chinese hamster ovary (CHO) cells, derived from the cell line CHO-K1, lacking the glutamine synthetase (GS-KO) gene, glycoform alfa
- immunoglobulin g1 anti human thymic stromal lymphopoietin human mus musculus monoclonal cm326 γ1 chain disulfide with human mus musculus monoclonal cm326 κ chain dimer
- immunoglobulin g1 kappa anti homo sapiens tslp thymic stromal lymphopoietin humanized monoclonal antibody
- immunoglobulin G1-kappa, anti-[Homo sapiens TSLP (thymic stromal lymphopoietin)], humanized monoclonal antibody
- Immunoglobulin G1, anti-(human thymic stromal lymphopoietin) (human-Mus musculus monoclonal CM326 γ1-chain), disulfide with human-Mus musculus monoclonal CM326 κ-chain, dimer
- ocankitug
- Ocankitug
- ocankitug [INN]
- ocankitug inn
- CAS registry numbers
- 2803351-66-6
- ChEMBL ID
- CHEMBL6068152
- FDA ingredient codes (UNII)
- 6Q8BN3S6AD
- First in class
- No
- Orphan designation
- No
- Condition
- Dermatitis, Atopic
- Highest recorded phase
- 2
- Condition identifier
- EFO:0000274
- Subject identifier
- D003876
- Condition
- Asthma
- Highest recorded phase
- 2
- Condition identifier
- MONDO:0004979
- Subject identifier
- D001249
- Condition
- Inflammation
- Highest recorded phase
- 2
- Condition identifier
- MP:0001845
- Subject identifier
- D007249
- Condition identifier
- EFO_0000274
- Highest recorded phase
- 2
- Condition identifier
- EFO_1002029
- Highest recorded phase
- 1
- Condition identifier
- EFO_1002029
- Highest recorded phase
- 2
- Condition identifier
- MONDO_0004979
- Highest recorded phase
- 1
- Condition identifier
- MONDO_0004979
- Highest recorded phase
- 3
- Condition identifier
- MONDO_0004980
- Highest recorded phase
- 2
- Condition identifier
- MP_0001845
- NCT04842201
- NCT05171348
- NCT05774340
- NCT05186922
- NCT05671432
- NCT05671445
- Prodrug
- No
- Chirality
- Single enantiomer
- Inorganic
- No
- Natural product
- No
- Component
- Heavy chain
- Type
- Protein
- Sequence
- QVQLVQSGAEVKKPGSSVKVSCKASGYTFTDYWMHWVRQAPGQGLEWMGIIDPSDSDTSLNQKFQGRVTITADTSTSTAYMELSSLRSEDTAVYYCARSLDGYYDYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
- Component
- Disulfide bridges
- Sequence
- 22-96 $ 22''-96'' $ 23'-88' $ 23'''-88''' $ 134'-194' $ 134'''-194''' $ 144-200 $ 144''-200'' $ 220-214' $ 220''-214''' $ 226-226'' $ 229-229'' $ 261-321 $ 261''-321'' $ 367-425 $ 367''-425''
- Component
- Light chain
- Type
- Protein
- Sequence
- DIQMTQSPSSLSASVGDRVTITCRTSENIYSYLAWYQQKPGKAPKLLIYFAKTLTDGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQHHYGTPWTFGQGTKVEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC
- Component
- Glycosylation sites (N)
- Sequence
- 297 $ 297''
Related records
Trials (13)
- A Comparative Pharmacokinetic Study of CM326 in Healthy Subjects
- A Multiple Ascending Doses Study of CM326 Injection in Healthy Subjects
- A Phase II Study of CM326 in Subjects With Moderate to Severe Chronic Obstructive Pulmonary Disease
- A Phase III Study of CM326 in Subjects With Moderate to Severe Asthma
- A Randomized, Double-blind, Placebo-controlled Phase III Study to Evaluate the Efficacy and Safety of CM326 in Participants With Chronic Rhinosinusitis With Nasal Polyposis
- A Study of CM326 in Patients With Chronic Rhinosinusitis With Nasal Polyps
- A Study of CM326 in Subjects With Moderate to Severe Asthma
- Single Ascending Dose Study of CM326 in Healthy Volunteers
- Study of CM326 in Participants With Chronic Rhinosinusitis With Nasal Polyposis
- Study of CM326 Injection in Healthy Subjects
- The Study of CM326 in Adult Subjects With Atopic Dermatitis
- The Study of CM326 in Moderate-to-severe Atopic Dermatitis
- The Study of CM326 in Patients With Moderate-to-severe Atopic Dermatitis
In development for (2)
- Asthma Phase 2
- Atopic eczema Phase 2