Nezutatug
Highest phase reached
Phase 2
Drug type
Antibody
- Listing at source
- Listed
- Highest phase reached
- Phase 2
- Drug type
- Antibody
- Drug name
- Nezutatug
- Gamma1 heavy chain humanized (1-450) [VH (Homo sapiens IGHV4-31*01 (89.9%) -(IGHD) -IGHJ4*01 (92.9%), CDR-IMGT [9.7.13] (26-34.52-58.97-109)) (1-120) -Homo sapiens IGHG1*01 (100%), G1m17,1 CH1 K120, D12, L14 (CH1 K120 (217) (121-218), hinge 1-15 (219-233), CH2 (234-343), CH3 D12 (359), L14 (361) (344-448), CHS (449-450)) (121-450)], (223-214')-disulfide with kappa light chain humanized (1'-214') [V-KAPPA (Homo sapiens IGKV1-12*01 (85.3%)-IGKJ2*01 (100%), CDR-IMGT [6.3.9] (27-32.50-52.89-97)) (1'-107') -Homo sapiens IGKC*01 (100%), Km3 A45.1 (153), V101 (191) (108'-214')]; dimer (229-229'':232-232'')-bisdisulfide, produced in Chinese hamster ovary (CHO) cells, derived from the cell line CHO-K1,glycoform alfa
- gamma1 heavy chain humanized 1 450 vh homo sapiens ighv4 31 01 89 9 ighd ighj4 01 92 9 cdr imgt 9 7 13 26 34 52 58 97 109 1 120 homo sapiens ighg1 01 100 g1m17 1 ch1 k120 d12 l14 ch1 k120 217 121 218 hinge 1 15 219 233 ch2 234 343 ch3 d12 359 l14 361 344 448 chs 449 450 121 450 223 214 disulfide with kappa light chain humanized 1 214 v kappa homo sapiens igkv1 12 01 85 3 igkj2 01 100 cdr imgt 6 3 9 27 32 50 52 89 97 1 107 homo sapiens igkc 01 100 km3 a45 1 153 v101 191 108 214 dimer 229 229 232 232 bisdisulfide produced in chinese hamster ovary cho cells derived from the cell line cho k1 glycoform alfa
- hmbd 001
- Hmbd-001
- HMBD-001
- immunoglobulin g1 anti human epidermal growth factor receptor her3 human mus musculus monoclonal hmbd 001 γ1 chain disulfide with human mus musculus monoclonal hmbd 001 κ chain dimer
- Immunoglobulin G1, anti-(human epidermal growth factor receptor HER3) (human-Mus musculus monoclonal HMBD-001 γ1-chain), disulfide with human-Mus musculus monoclonal HMBD-001 κ-chain, dimer
- nezutatug
- Nezutatug
- Nezutatug (Immunoglobulin G1-kappa, anti-[Homo sapiens ERBB3 (receptor tyrosine-protein kinase erbB-3, HER3)], humanized monoclonal antibody)
- nezutatug [INN]
- nezutatug immunoglobulin g1 kappa anti homo sapiens erbb3 receptor tyrosine protein kinase erbb 3 her3 humanized monoclonal antibody
- nezutatug inn
- CAS registry numbers
- 2673271-78-6
- ChEMBL ID
- CHEMBL5315023
- FDA ingredient codes (UNII)
- HZZ2SGC2TW
- First in class
- No
- Orphan designation
- No
- Condition
- Neoplasms
- Highest recorded phase
- 2
- Condition identifier
- EFO:0000616
- Subject identifier
- D009369
- Condition
- Carcinoma, Non-Small-Cell Lung
- Highest recorded phase
- 1
- Condition identifier
- EFO:0003060
- Subject identifier
- D002289
- Condition identifier
- EFO_0000616
- Condition identifier
- MONDO_0005070
- Condition identifier
- MONDO_0005096
- Highest recorded phase
- 1
- Condition identifier
- MONDO_0005233
- Highest recorded phase
- 1
- Condition identifier
- MONDO_0008315
- Highest recorded phase
- 1
Trial references
- NCT05910827
- Prodrug
- No
- Chirality
- Single enantiomer
- Inorganic
- No
- Natural product
- No
- Component
- Heavy chain
- Type
- Protein
- Sequence
- QVQLQESGPGLVKPSQTLSLTCTVSGYSITSGYSWHWIRQHPGKGLEWIGSIRYSGGTDYNPSLKSLVTISADTSKNQFSLKLSSVTAADTAVYYCARMTTAPWYPFDYWGQGTTVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
- Component
- Light chain
- Type
- Protein
- Sequence
- DIQMTQSPSSVSASVGDRVTITCKASQIVGSNVAWYQQKPGKAPEPLIYSASYLYSGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQYSSHPLTFGQGTKLEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC
- Component
- Glycosylation sites (N)
- Sequence
- 300 $ 300''
- Component
- Disulfide bridges
- Sequence
- 22-96 $ 22''-96'' $ 23'-88' $ 23'''-88''' $ 134'-194' $ 134'''-194''' $ 147-203 $ 147''-203'' $ 223-214' $ 223''-214''' $ 229-229'' $ 232-232'' $ 264-324 $ 264''-324'' $ 370-428 $ 370''-428''
Related records
Trials (3)
- A Phase I/IIa Trial of HMBD-001 in Advanced HER3 Positive Solid Tumours
- A Phase Ib/II Study of an Anti-HER3 Antibody, HMBD-001, With Cetuximab +/- Docetaxel in Advanced Squamous Cell Cancers
- Study of an Anti-HER3 Antibody, HMBD-001, With or Without Chemotherapy in Patients With Solid Tumors Harboring an NRG1 Fusion or HER3 Mutation
In development for (2)
- Neoplasm Phase 2
- Non-small cell lung carcinoma Phase 1