Maridebart
Highest phase reached
Phase 2
Drug type
Antibody
- Listing at source
- Listed
- Highest phase reached
- Phase 2
- Drug type
- Antibody
- Drug name
- Maridebart
- AMG 133 mAb (PARENT)
- amg 133 mab parent
- amg 133 parent
- AMG-133 (PARENT)
- gamma1 heavy chain Homo sapiens (1-450) [VH (Homo sapiens IGHV3-33*01 (92.9%) -(IGHD) -IGHJ4*01 (100%), CDR-IMGT [8.8.13] (26-33.51-58.97-109)) (1-120) -Homo sapiens IGHG1*03v, G1m3>G1m17, nG1m1 CH1 K120, CH3 E12, M14, G1v64 CH2 C36, G1v54-30 CH2 C83, G84.4, C85 (CH1 R120>K (217) (121-218), hinge 1-15 (219-233), CH2 E36>C (275), R83>C (295), N84.4>G (300), V85>C (305) (234-343), CH3 E12(359), M14 (361) (344-448), CHS (449-450)) (121-450)], (223-214')-disulfide with kappa light chain Homo sapiens (1'-214') [V-KAPPA (Homo sapiens IGKV3-15*01 (97.9%) -IGKJ4*01(100%), CDR-IMGT [6.3.9] (27-32.51-53.89-97)) (1'-107') -Homo sapiens IGKC*01 (100%), Km3 A45.1 (153), V101 (191) (108'-214')]; dimer (229-229'':232-232'')-bisdisulfide, produced in Chinese hamster ovary (CHO) cells, glycoform alfa
- gamma1 heavy chain homo sapiens 1 450 vh homo sapiens ighv3 33 01 92 9 ighd ighj4 01 100 cdr imgt 8 8 13 26 33 51 58 97 109 1 120 homo sapiens ighg1 03v g1m3 g1m17 ng1m1 ch1 k120 ch3 e12 m14 g1v64 ch2 c36 g1v54 30 ch2 c83 g84 4 c85 ch1 r120 k 217 121 218 hinge 1 15 219 233 ch2 e36 c 275 r83 c 295 n84 4 g 300 v85 c 305 234 343 ch3 e12 359 m14 361 344 448 chs 449 450 121 450 223 214 disulfide with kappa light chain homo sapiens 1 214 v kappa homo sapiens igkv3 15 01 97 9 igkj4 01 100 cdr imgt 6 3 9 27 32 51 53 89 97 1 107 homo sapiens igkc 01 100 km3 a45 1 153 v101 191 108 214 dimer 229 229 232 232 bisdisulfide produced in chinese hamster ovary cho cells glycoform alfa
- immunoglobulin g1 anti glucose dependent insulinotropic polypeptide receptor 275 cysteine 295 cysteine 300 glycine 305 cysteine human γ1 chain disulfide with human κ chain dimer
- immunoglobulin g1 kappa anti homo sapiens gipr gastric inhibitory polypeptide receptor homo sapiens monoclonal antibody gamma1 heavy chain homo sapiens 1 450 vh homo sapiens ighv3 33 01 92 9 ighd ighj4 01 100 cdrimgt 8 8 13 26 33 51 58 97 109 1 120 homo sapiens ighg1 03v g1m3 g1m17 ng1m1 ch1 k120 ch3 e12 m14 g1v64 ch2 c36 g1v54 30 ch2 c83 g84 4 c85 ch1 r120 k 217 121 218 hinge 1 15 219 233 ch2 e36 c 275 r83 c 295 n84 4 g 300 v85 c 305 234 343 ch3 e12 359 m14 361 344 448 chs 449 450 121 450 223 214 disulfide with kappa light chain homo sapiens 1 214 vkappa homo sapiens igkv3 15 01 97 9 igkj4 01 100 cdr imgt 6 3 9 27 32 51 53 89 97 1 107 homo sapiens igkc 01 100 km3 a45 1 153 v101 191 108 214 dimer 229 229 232 232 bisdisulfide produced in chinese hamster ovary cho cells glycoform alfa
- Immunoglobulin G1-kappa, anti-[Homo sapiens GIPR (gastric inhibitory polypeptide receptor)], Homo sapiens monoclonal antibody; gamma1 heavy chain Homo sapiens (1-450) [VH (Homo sapiens IGHV3-33*01 (92.9%)-(IGHD) -IGHJ4*01 (100%), CDRIMGT [8.8.13] (26-33.51-58.97-109)) (1-120) -Homo sapiens IGHG1*03v, G1m3>G1m17, nG1m1 CH1 K120, CH3 E12, M14, G1v64 CH2 C36, G1v54-30 CH2 C83, G84.4, C85 (CH1 R120>K (217) (121-218), hinge 1-15 (219-233), CH2 E36>C (275), R83>C (295), N84.4>G (300), V85>C (305) (234-343), CH3 E12 (359), M14 (361) (344-448), CHS (449-450)) (121-450)], (223-214')-disulfide with kappa light chain Homo sapiens (1'-214') [VKAPPA (Homo sapiens IGKV3-15*01 (97.9%) -IGKJ4*01 (100%), CDR-IMGT [6.3.9] (27-32.51-53.89-97)) (1'-107') -Homo sapiens IGKC*01 (100%), Km3 A45.1 (153), V101 (191) (108'-214')]; dimer (229-229'':232-232'')-bisdisulfide, produced in Chinese hamster ovary (CHO) cells, glycoform alfa
- Immunoglobulin G1, anti-(glucose-dependent insulinotropic polypeptide receptor) [275-cysteine,295-cysteine,300-glycine,305-cysteine] (human γ1-chain), disulfide with human κ-chain, dimer
- maridebart
- Maridebart
- maridebart [INN]
- MARIDEBART [USAN]
- maridebart inn
- maridebart usan
- CAS registry numbers
- 2761478-99-1
- ChEMBL ID
- CHEMBL5314750
- FDA ingredient codes (UNII)
- 76AFN9QO5H
- First in class
- No
- Orphan designation
- No
- Pharmacology name
- maridebart cafraglutide
- Type
- Antibody
- Drug name stem
- -bart
- Action type
- Agonist
- Target
- GLP-1 receptor
- Gene symbol
- GLP-1 receptor
- Action type
- Antagonist
- Target
- GIP receptor
- Gene symbol
- GIP receptor
- Prodrug
- No
- Chirality
- Single enantiomer
- Inorganic
- No
- Natural product
- No
- Component
- Heavy chain
- Type
- Protein
- Sequence
- QVQLVESGGGVVQPGRSLRLSCAASGFTFSNYGMHWVRQAPGEGLEWVAAIWFDASDKYYADAVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARDQAIFGVVPDYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPCVKENWYVDGVEVHNAKTKPCEEQYGSTYRCVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVESCSVMHEALHNHYTQKSLSLSPGK
- Component
- Light chain
- Type
- Protein
- Sequence
- EIVMTOSPATLSVSPGERATLSCRASQSVSSNLAWYOQKPGQAPRLLIYGAATRATGIPARVSGSGSGTEFTLTISSLOSEDFAVYYCQQYNNWPLTFGGGTKVEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSENRGEC
- Component
- Disulfide bridges
- Sequence
- 22-96 $ 22''-96'' $ 23'-88' $ 23'''-88''' $ 134'-194' $ 134'''-194''' $ 147-203 $ 147''-203'' $ 223-214' $ 223''-214''' $ 229-229'' $ 232-232'' $ 264-324 $ 264''-324'' $ 295-305 $ 295''-305'' $ 370-428 $ 370''-428''
- Component
- Glycosylation sites (N)
- Sequence
- 300 $ 300''
Related records
Trials (152)
- A Glucometabolic Evaluation of Patients With Idiopathic Ketotic Hypoglycemia
- A Research Study Comparing RYBELSUS® to Other Blood Sugar Lowering Tablets in People Living in America With Type 2 Diabetes (REALYSE)
- A Single-dose Cross-over Study to Assess Direct and Indirect Effects of Dapagliflozin on Pancreatic Alpha and Beta Cells in Patients With Type 2 Diabetes
- A Study Looking at How Weekly Injections of Two Hormones - GIP and Amylin - Affect Stomach-related Side Effects in People Who Are Overweight or Obese
- A Study to Demonstrate Bioequivalence Between Insulin Glulisine U300 and Insulin Glulisine U100 After a Single Subcutaneous Dose Using the Euglycemic Clamp Technique, in Patients With Type 1 Diabetes Mellitus
- A Study to Evaluate a Potassium Normalization Treatment Regimen Including Sodium Zirconium Cyclosilicate (ZS) Among Patients With S-K ≥5.8
- A Study to Evaluate AMG 133 Administered Subcutaneously in Participants With Overweight or Obesity
- A Study to Evaluate AMG 133 in Participants With Varying Degrees of Hepatic Impairment or Normal Hepatic Function
- A Trial to Assess Bioavailability of AMG 133 in Participants With Overweight or Obesity
- A Trial to Assess the Effect of Kidney Impairment on How AMG 133 is Absorbed, Broken Down, and Eliminated by the Body
- A Trial to Evaluate Interactions Between Antiemetic Medication and AMG 133 in Participants Living With Overweight or Obesity
- Add-on Sodium Nitroprusside to Treatment as Usual in Schizophrenia
- ADD-ON Study to Existing Hypoparathyroidism Studies
- Analgesic Effect of Oral 25% Glucose Versus Oral 24% Sucrose for Pain Relief During Heel Lance in Preterm Neonates
- Analgesic Efficacy of Oral Glucose in Preterm Neonates During Suctioning
- Antioxidation Medication for Noise-induced Hearing Loss
- Assessing Brain Metabolism Using MRS With Deuterated Glucose
- Autonomic Nervous System Reactivity of the Newborn After a Nociceptive Stress: Interest of Sucrose and Non-nutritive Sucking
- Behavioral Parent Training With and Without AI Support for Children With Disruptive Behaviors
- Beta Cell Function in (Pre) Type 1 Diabetes