Maridebart cafraglutide
Highest phase reached
Phase 2
Drug type
Antibody drug conjugate
- Listing at source
- Listed
- Highest phase reached
- Phase 2
- Drug type
- Antibody drug conjugate
- Drug name
- Maridebart cafraglutide
- amg 133
- AMG 133
- AMG-133
- gamma1 heavy chain Homo sapiens (1-450) [VH (Homo sapiens IGHV3-33*01 (92.9%) -(IGHD) -IGHJ4*01 (100%), CDR-IMGT [8.8.13] (26-33.51-58.97-109)) (1-120) -Homo sapiens IGHG1*03v, G1m3>G1m17, nG1m1 CH1 K120, CH3 E12, M14, G1v64 CH2 C36, G1v54-30 CH2 C83, G84.4, C85 (CH1 R120>K (217) (121-218), hinge 1-15 (219-233), CH2 E36>C (275), R83>C (295), N84.4>G (300), V85>C (305) (234-343), CH3 E12 (359), M14 (361) (344-448), CHS (449-450)) (121-450)], (223-214')-disulfide with kappa light chain Homo sapiens (1'-214') [V-KAPPA (Homo sapiens IGKV3-15*01 (97.9%)-IGKJ4*01 (100%), CDR-IMGT [6.3.9] (27-32.51-53.89-97)) (1'-107') -Homo sapiens IGKC*01 (100%), Km3 A45.1 (153), V101 (191) (108'-214')]; dimer (229-229'':232-232'')-bisdisulfide, produced in Chinese hamster ovary (CHO) cells, glycoform alfa; 275,275''-bis(thioether) conjugated to a glucagon-like peptide 1(GLP-1) analogue (GCG (glucagon) 98-126, GLP-1 7-35 A8>methylalanine (2), V16>Y (10), G22>E (16)), via a fused 18-mer linker (diglycyl- tris(tetraglycyl-seryl)-lysinamide
- gamma1 heavy chain homo sapiens 1 450 vh homo sapiens ighv3 33 01 92 9 ighd ighj4 01 100 cdr imgt 8 8 13 26 33 51 58 97 109 1 120 homo sapiens ighg1 03v g1m3 g1m17 ng1m1 ch1 k120 ch3 e12 m14 g1v64 ch2 c36 g1v54 30 ch2 c83 g84 4 c85 ch1 r120 k 217 121 218 hinge 1 15 219 233 ch2 e36 c 275 r83 c 295 n84 4 g 300 v85 c 305 234 343 ch3 e12 359 m14 361 344 448 chs 449 450 121 450 223 214 disulfide with kappa light chain homo sapiens 1 214 v kappa homo sapiens igkv3 15 01 97 9 igkj4 01 100 cdr imgt 6 3 9 27 32 51 53 89 97 1 107 homo sapiens igkc 01 100 km3 a45 1 153 v101 191 108 214 dimer 229 229 232 232 bisdisulfide produced in chinese hamster ovary cho cells glycoform alfa 275 275 bis thioether conjugated to a glucagon like peptide 1 glp 1 analogue gcg glucagon 98 126 glp 1 7 35 a8 methylalanine 2 v16 y 10 g22 e 16 via a fused 18 mer linker diglycyl tris tetraglycyl seryl lysinamide
- immunoglobulin g1 anti glucose dependent insulinotropic polypeptide receptor 275 cysteine 295 cysteine 300 glycine 305 cysteine human γ1 chain disulfide with human κ chain dimer
- immunoglobulin g1 anti glucose dependent insulinotropic polypeptide receptor 275 cysteine 295 cysteine 300 glycine 305 cysteine human γ1 chain disulfide with human κ chain dimer 275 275 bis thioether with 7 37 glucagon like peptide i 8 2 methylalanine 16 tyrosine 22 glutamic acid 36 glycine human fusion protein with peptide linker ggggs 3 n6 2 mercaptoacetyl lysinamide
- immunoglobulin g1 kappa anti homo sapiens gipr gastric inhibitory polypeptide receptor homo sapiens monoclonal antibody gamma1 heavy chain homo sapiens 1 450 vh homo sapiens ighv3 33 01 92 9 ighd ighj4 01 100 cdrimgt 8 8 13 26 33 51 58 97 109 1 120 homo sapiens ighg1 03v g1m3 g1m17 ng1m1 ch1 k120 ch3 e12 m14 g1v64 ch2 c36 g1v54 30 ch2 c83 g84 4 c85 ch1 r120 k 217 121 218 hinge 1 15 219 233 ch2 e36 c 275 r83 c 295 n84 4 g 300 v85 c 305 234 343 ch3 e12 359 m14 361 344 448 chs 449 450 121 450 223 214 disulfide with kappa light chain homo sapiens 1 214 vkappa homo sapiens igkv3 15 01 97 9 igkj4 01 100 cdr imgt 6 3 9 27 32 51 53 89 97 1 107 homo sapiens igkc 01 100 km3 a45 1 153 v101 191 108 214 dimer 229 229 232 232 bisdisulfide produced in chinese hamster ovary cho cells glycoform alfa
- Immunoglobulin G1-kappa, anti-[Homo sapiens GIPR (gastric inhibitory polypeptide receptor)], Homo sapiens monoclonal antibody; gamma1 heavy chain Homo sapiens (1-450) [VH (Homo sapiens IGHV3-33*01 (92.9%)-(IGHD) -IGHJ4*01 (100%), CDRIMGT [8.8.13] (26-33.51-58.97-109)) (1-120) -Homo sapiens IGHG1*03v, G1m3>G1m17, nG1m1 CH1 K120, CH3 E12, M14, G1v64 CH2 C36, G1v54-30 CH2 C83, G84.4, C85 (CH1 R120>K (217) (121-218), hinge 1-15 (219-233), CH2 E36>C (275), R83>C (295), N84.4>G (300), V85>C (305) (234-343), CH3 E12 (359), M14 (361) (344-448), CHS (449-450)) (121-450)], (223-214')-disulfide with kappa light chain Homo sapiens (1'-214') [VKAPPA (Homo sapiens IGKV3-15*01 (97.9%) -IGKJ4*01 (100%), CDR-IMGT [6.3.9] (27-32.51-53.89-97)) (1'-107') -Homo sapiens IGKC*01 (100%), Km3 A45.1 (153), V101 (191) (108'-214')]; dimer (229-229'':232-232'')-bisdisulfide, produced in Chinese hamster ovary (CHO) cells, glycoform alfa
- Immunoglobulin G1, anti-(glucose-dependent insulinotropic polypeptide receptor) [275-cysteine,295-cysteine,300-glycine,305-cysteine] (human γ1-chain), disulfide with human κ-chain, dimer
- Immunoglobulin G1, anti-(glucose-dependent insulinotropic polypeptide receptor) [275-cysteine,295-cysteine,300-glycine,305-cysteine] (human γ1-chain), disulfide with human κ-chain, dimer, 275,275′-bis(thioether) with 7-37-glucagon-like peptide I [8-(2-methylalanine),16-tyrosine,22-glutamic acid,36-glycine] (human) fusion protein with peptide linker ((GGGGS)3-N6-(2-mercaptoacetyl)lysinamide)
- maridebart cafraglutida
- Maridebart cafraglutida
- maridebart cafraglutide
- Maridebart cafraglutide
- Maridebart Cafraglutide
- maridebart cafraglutide [INN]
- MARIDEBART CAFRAGLUTIDE [USAN]
- maridebart cafraglutide inn
- maridebart cafraglutide usan
- CAS registry numbers
- 2760218-55-9
- ChEMBL ID
- CHEMBL5314751
- FDA ingredient codes (UNII)
- Z24U3U73HN
- First in class
- No
- Orphan designation
- No
- Pharmacology name
- maridebart cafraglutide
- Type
- Antibody
- Drug name stem
- -bart; -tide
- Action
- Agonist
- Action type
- Agonist
- Target
- GLP-1 receptor
- Gene symbol
- GLP1R
- Protein identifier
- P43220
- Median affinity
- 7.61
- Affinity units
- pEC50
- Action
- Antagonist
- Action type
- Antagonist
- Target
- GIP receptor
- Gene symbol
- GIPR
- Protein identifier
- P48546
- Median affinity
- 7.37
- Affinity units
- pIC50
- Condition identifier
- EFO_0001073
- Highest recorded phase
- 3
- Condition identifier
- EFO_0003918
- Highest recorded phase
- 3
- Condition identifier
- HP_0001513
- Highest recorded phase
- 3
- Condition identifier
- HP_0025502
- Highest recorded phase
- 3
- Condition identifier
- MONDO_0005148
- Highest recorded phase
- 2
- Condition identifier
- MONDO_0005148
- Highest recorded phase
- 3
- Condition identifier
- MONDO_0007147
- Highest recorded phase
- 3
- Prodrug
- No
- Chirality
- Single enantiomer
- Inorganic
- No
- Natural product
- No
- Component
- Heavy chain
- Type
- Protein
- Sequence
- QVQLVESGGGVVQPGRSLRLSCAASGFTFSNYGMHWVRQAPGEGLEWVAAIWFDASDKYYADAVKGRETISRDNSKNTLYLQMNSLRAEDTAVYYCARDQAIFGVVPDYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPCVKENWYVDGVEVHNAKTKPCEEQYGSTYRCVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVESCSVMHEALHNHYTQKSLSLSPGK
- Component
- Disulfide bridges
- Sequence
- 22-96 $ 22''-96'' $ 23'-88' $ 23'''-88''' $ 134'-194' $ 134'''-194''' $ 147-203 $ 147''-203'' $ 223-214' $ 223''-214''' $ 229-229'' $ 232-232'' $ 264-324 $ 264''-324'' $ 295-305 $ 295''-305'' $ 370-428 $ 370''-428''
- Component
- Light chain
- Type
- Protein
- Sequence
- EIVMTQSPATLSVSPGERATLSCRASQSVSSNLAWYQQKPGQAPRLLIYGAATRATGIPARVSGSGSGTEFTLTISSLQSEDFAVYYCQQYNNWPLTEGGGTKVEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC
- Component
- Glycosylation sites (N)
- Sequence
- 300 $ 300''
Related records
Trials (20)
- A Study of Maridebart Cafraglutide in Adult Participants With Type 2 Diabetes Mellitus (T2DM)
- A Study to Evaluate AMG 133 in Chinese Participants With Obesity or Overweight
- A Study to Evaluate the Effect of Maridebart Cafraglutide on Insulin Sensitivity and β-cell Function in Participants With Type 2 Diabetes Mellitus
- A Trial to Compare the Extent to Which Maridebart Cafraglutide (AMG 133) is Made Available in the Body When Administered Using Two Subcutaneous Presentations
- A Trial to Evaluate Efficacy and Safety of Maridebart Cafraglutide in Adults Living With Elevated Liver Fat and Obesity or Overweight
- Comparing the Extent to Which Maridebart Cafraglutide (AMG 133) is Made Available in the Body When Administered Using Two Subcutaneous (SC) Presentations
- Dose-ranging Study to Evaluate the Efficacy, Safety, and Tolerability of AMG 133 in Adult Subjects With Overweight or Obesity, With or Without Type 2 Diabetes Mellitus
- Effect of Maridebart Cafraglutide on How Oral Contraceptives Are Absorbed and Processed in the Body in Postmenopausal Female Participants Living With Overweight or Obesity
- Effect of Maridebart Cafraglutide on the Heart's Electrical Activity
- Efficacy and Safety of Maridebart Cafraglutide in Adult Participants in Japan Who Have Obesity Disease
- Efficacy and Safety of Maridebart Cafraglutide in Adult Participants With Type 2 Diabetes Mellitus Who Have Obesity or Are Overweight
- Efficacy, Safety and Tolerability of Switching From Glucagon-like Peptide-1 Receptor Agonists (GLP-1RA) to Maridebart Cafraglutide in Adults With Obesity or Overweight (MARITIME-SWITCH)
- Evaluating the Impact of Maridebart Cafraglutide on Cardiovascular Outcomes in Participants With Atherosclerotic Cardiovascular Disease and Overweight or Obesity
- Evaluation of Maridebart Cafraglutide in Adult Participants Without Type 2 Diabetes Mellitus Who Have Obesity or Are Overweight
- Extension Trial to Evaluate the Long-term Efficacy, Safety, and Tolerability of Maridebart Cafraglutide (MARITIME-1-EXTENSION)
- Extension Trial to Evaluate the Long-term Efficacy, Safety, and Tolerability of Maridebart Cafraglutide (MARITIME-2-EXTENSION)
- Maridebart Cafraglutide in Heart Failure With Preserved or Mildly Reduced Ejection Fraction and Obesity
- Maridebart Cafraglutide Versus Placebo in Adult Participants With Obstructive Sleep Apnea Not on Positive Airway Pressure (PAP) Therapy
- Maridebart Cafraglutide Versus Placebo in Adult Participants With Obstructive Sleep Apnea on Positive Airway Pressure Therapy
- Single and Multiple Ascending Dose Study of AMG 133 in Participants With Obesity
In development for (3)
- Obesity disorder Phase 3
- Obstructive sleep apnea syndrome Phase 3
- Type 2 diabetes mellitus Phase 2