Lancastotug
Highest phase reached
Phase 2
Drug type
Antibody
- Listing at source
- Listed
- Highest phase reached
- Phase 2
- Drug type
- Antibody
- Drug name
- Lancastotug
- ak 127
- Ak 127
- AK-127
- ak127
- Ak127
- AK127
- Gamma1 heavy chain humanized (1-451) [VH (Homo sapiens IGHV4-30-4*01 (90.8%) -(IGHD) -IGHJ4*01 (92.3%) L123>S (116), CDR-IMGT [9.7.14] (26-34.52-58.97-110)) (1-121) -Homo sapiens IGHG1*03v,G1m3>G1m17, nG1m1, CH1 K120, CH3 E12, M14 (CH1R120>K (218) (122-219), hinge 1-15 (220-234), CH2 (235-344), CH3 E12 (360), M14 (362) (345-449), CHS (450-451))(122-451)], (224-214')-disulfide with kappa light chain humanized (1'-214') [V-KAPPA (Homo sapiens IGKV1-9*03 (85.4%) -IGKJ4*01 (90.9%) V124>L (104), CDR-IMGT [6.3.9] (27-32.50-52.89-97)) (1'-107') -Homo sapiens IGKC*01 (100%), Km3, A45.1 (153), V101 (191) (108'-214')]; dimer (230-230'':233-233'')-bisdisulfide, produced in Chinese hamster ovary (CHO) cells, glycoform alfa
- gamma1 heavy chain humanized 1 451 vh homo sapiens ighv4 30 4 01 90 8 ighd ighj4 01 92 3 l123 s 116 cdr imgt 9 7 14 26 34 52 58 97 110 1 121 homo sapiens ighg1 03v g1m3 g1m17 ng1m1 ch1 k120 ch3 e12 m14 ch1r120 k 218 122 219 hinge 1 15 220 234 ch2 235 344 ch3 e12 360 m14 362 345 449 chs 450 451 122 451 224 214 disulfide with kappa light chain humanized 1 214 v kappa homo sapiens igkv1 9 03 85 4 igkj4 01 90 9 v124 l 104 cdr imgt 6 3 9 27 32 50 52 89 97 1 107 homo sapiens igkc 01 100 km3 a45 1 153 v101 191 108 214 dimer 230 230 233 233 bisdisulfide produced in chinese hamster ovary cho cells glycoform alfa
- immunoglobulin g1 anti human receptor tigit human mus musculus monoclonal ak127 γ1 chain disulfide with human mus musculus monoclonal ak127 κ chain dimer
- Immunoglobulin G1, anti-(human receptor TIGIT) (human-Mus musculus monoclonal AK127 γ1-chain), disulfide with human-Mus musculus monoclonal AK127 κ-chain, dimer
- lancastotug
- Lancastotug
- lancastotug [INN]
- Lancastotug [WHO-DD]
- lancastotug inn
- lancastotug who dd
- mmunoglobulin g1 kappa anti homo sapiens tigit t cell immunoreceptor with ig domain and itim v set ig member 9 vsig9 v set and transmembrane member 3 vstm3 humanized monoclonal antibody
- mmunoglobulin G1-kappa, anti-[Homo sapiens TIGIT (T cell immunoreceptor with Ig domain and ITIM, V-set Ig member 9, VSIG9, V-set and transmembrane member 3, VSTM3)], humanized monoclonal antibody
- CAS registry numbers
- 2768355-20-8
- ChEMBL ID
- CHEMBL5314843
- FDA ingredient codes (UNII)
- JP3KZB9R7C
- First in class
- No
- Orphan designation
- No
Investigated indications
- Condition
- Neoplasms
- Highest recorded phase
- 2
- Condition identifier
- EFO:0000616
- Subject identifier
- D009369
- Condition identifier
- EFO_0000616
- Condition identifier
- MONDO_0004992
- Highest recorded phase
- 1
- Condition identifier
- MONDO_0005070
- Condition identifier
- MONDO_0007256
- Highest recorded phase
- 1
- NCT05021120
- NCT05393063
- Prodrug
- No
- Chirality
- Single enantiomer
- Inorganic
- No
- Natural product
- No
- Component
- Heavy chain
- Type
- Protein
- Sequence
- DVQLQESGPGLVKPSQTLSLTCTVSGHSFTSDYAWSWIRQPPGKGLEWIGYISYSDSTNYNPSLKSRVTISRDTSKNQFSLKLSSVTAADTAVYYCARLDYGNYGGAMDYWGQGTSVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
- Component
- Light chain
- Type
- Protein
- Sequence
- DIQMTQSPSSLSASVGDRVTITCRSSQHVSTALAWYQQKPGKSPKLLIYSASSRYSGVPDRFSGSGSGTDFTFTISSLQPEDFATYYCQQHYITPWTFGGGTKLEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC
- Component
- Disulfide bridges
- Sequence
- 22-96 $ 22''-96'' $ 23'-88' $ 23'''-88''' $ 134'-194' $ 134'''-194''' $ 148-204 $ 148''-204'' $ 224-214' $ 224''-214''' $ 230-230'' $ 233-233'' $ 265-325 $ 265''-325'' $ 371-429 $ 371''-429''
- Component
- Glycosylation sites (N)
- Sequence
- 301 $ 301''
Related records
Trials (5)
- A Phase Ia/Ib Open Label，Clinical Study Evaluating the Safety, Tolerability and Preliminary Efficacy of AK127 in Combination With AK104 in Patients With Advanced Malignant Tumors
- A Phase Ib/II Clinical Study of AK127 in Combination With AK112 in Patients With Advanced Solid Tumors
- A Study of AK112 in Patients With Advanced Hepatocellular Carcinoma (HCC)
- A Study to Evaluate the Efficacy and Safety of AK127 in Patients With Advanced Solid Tumors
- A Study to Evaluate the Safety, Pharmacokinetics, and Antitumor Activity of AK127 in Combination With AK104 in Advanced and Metastatic Solid Tumours
In development for (1)
- Neoplasm Phase 2