Izalontamab brengitecan

Highest phase reached
Phase 2
www.ebi.ac.uk
Drug type
Antibody drug conjugate
www.ebi.ac.uk

Listing at source
Listed
Highest phase reached
Phase 2
www.ebi.ac.uk

Drug type
Antibody drug conjugate
www.ebi.ac.uk
Drug name
Izalontamab brengitecan
www.ebi.ac.uk

  • bl b01d1
  • BL B01D1 [WHO-DD]
  • bl b01d1 who dd
  • BL-B01D1
  • BL-B01D1 for Injection
  • bms 986507
  • BMS-986507
  • bms986507
  • BMS986507
  • fused g1 scfv heavy lambda heavy chain chimeric and homo sapiens 1 702 gamma1 heavy chain anti egfr chimeric 1 448 vh mus musculus ighv2 2 03 93 8 ighd ighj3 01 92 9 a128 s 119 cdr imgt 8 7 13 26 33 51 57 96 108 1 119 homo sapiens ighg1 08p 100 g1m3 1 ch1 i103 201 r120 216 120 217 hinge 1 15 218 232 ch2 233 342 ch3 d12 358 l14 360 343 447 chs k2 del 448 120 448 10 mer bis tetraglycyl seryl linker 449 458 scfv heavy lambda anti erbb3 homo sapiens 459 702 vh homo sapiens ighv3 7 01 91 8 ighd ighj2 01 100 cdr imgt 8 8 11 484 491 509 516 555 565 459 576 15 mer tris tetraglycyl seryl linker 577 591 v lambda homo sapiens iglv2 14 03 93 9 iglj2 01 83 3 l124 v 699 cdr imgt 9 3 11 617 625 643 645 682 692 592 702 222 214 disulfide with kappa light chain anti egfr chimeric 1 214 v kappa mus musculus igkv5 48 01 95 8 igkj5 01 100 cdr imgt 6 3 9 27 32 50 52 89 97 1 107 homo sapiens igkc 01 100 km3 a45 1 153 v101 191 108 214 dimer 228 228 231 231 bisdisulfide produced in chinese hamster ovary cho cells glycoform alfa substituted at the sulfur atoms of the l cysteinyl residues 214 214 222 222 228 228 231 231 with 3rs 1 4s 13s 21s 13 benzyl 1 carboxy 22 1s 9s 9 ethyl 5 fluoro 9 hydroxy 4 methyl 10 13 dioxo 2 3 9 10 13 15 hexahydro 1h 12h benzo de pyrano 3 4 6 7 indolizino 1 2 b quinolin 1 yl amino 21 methyl 5 8 11 14 17 22 hexaoxo 20 oxa 2 6 9 12 15 18 hexaazadocosan 4 yl 2 5 dioxopyrrolidin 3 yl brengitecan groups
  • Fused G1-scFv heavy-lambda heavy chain chimeric and Homo sapiens (1-702) [gamma1 heavy chain anti-EGFR chimeric (1-448) [VH (Mus musculus IGHV2-2*03 (93.8%) -(IGHD) -IGHJ3*01 (92.9%) A128>S (119), CDR-IMGT [8.7.13] (26-33.51-57.96-108)) (1-119) -Homo sapiens IGHG1*08p (100%), G1m3,1 (CH1 I103 (201), R120 (216) (120-217), hinge 1-15 (218-232), CH2 (233-342), CH3 D12 (358), L14 (360) (343-447), CHS K2>del (448)) (120-448)] -10-mer bis(tetraglycyl-seryl) linker (449-458) -scFv heavy-lambda anti-ERBB3 Homo sapiens (459-702) [VH (Homo sapiens IGHV3-7*01 (91.8%) -(IGHD) -IGHJ2*01 (100%), CDR-IMGT [8.8.11] (484-491.509-516.555-565)) (459-576) -15-mer tris(tetraglycyl-seryl) linker (577-591) -V-LAMBDA (Homo sapiens IGLV2-14*03 (93.9%) -IGLJ2*01 (83.3%) L124>V (699), CDR-IMGT [9.3.11] (617-625.643-645.682-692)) (592-702)]], (222-214')-disulfide with kappa light chain anti-EGFR chimeric (1'-214') [V-KAPPA (Mus musculus IGKV5-48*01 (95.8%) -IGKJ5*01 (100%), CDR-IMGT [6.3.9] (27'-32'.50'-52'.89'-97')) (1'-107') -Homo sapiens IGKC*01 (100%), Km3 A45.1 (153'), V101 (191') (108'-214')]; dimer (228-228'':231-231'')-bisdisulfide, produced in Chinese hamster ovary (CHO) cells, glycoform alfa; substituted at the sulfur atoms of the L -cysteinyl residues 214', 214''', 222, 222'', 228, 228'', 231, 231'' with (3RS)-1-[(4S,13S,21S)-13-benzyl-1-carboxy-22-{[(1S,9S)-9-ethyl-5-fluoro-9-hydroxy-4-methyl-10,13-dioxo-2,3,9,10,13,15-hexahydro-1H,12H-benzo[de]pyrano[3',4':6,7]indolizino[1,2-b]quinolin-1-yl]amino}-21-methyl-5,8,11,14,17,22-hexaoxo-20-oxa-2,6,9,12,15,18-hexaazadocosan-4-yl]-2,5-dioxopyrrolidin-3-yl (brengitecan) groups
  • Immunoglobulin G1 [de-448-lysine], anti-(human epidermal growth factor receptor) (human-mouse monoclonal C225 γ1-chain) fusion protein with peptide linker (GGGGS)2 fusion protein with immunoglobulin anti-(human epidermal growth factor receptor HER3) (human clone HER3.H3 single-chain variable fragment VH-(GGGGS)3-VL), complex with human-mouse monoclonal C225 κ-chain, dimer, 214′′,214′′′,222,222′,228,228′,231,231′-octakis(thioether) with (2S)-N-(carboxymethyl)-2-(3-mercapto-2,5-dioxo-1-pyrrolidinyl)-β-alanylglycylglycyl-L-phenylalanyl-N-[[(1S)-2-[[(1S,9S)-9-ethyl-5-fluoro-2,3,9,10,13,15-hexahydro-9-hydroxy-4-methyl-10,13-dioxo-1H,12H-benzo[de]pyrano[3′,4′:6,7]indolizino[1,2-b]quinolin-1-yl]amino]-1-methyl-2-oxoethoxy]methyl]glycinamide
  • immunoglobulin g1 de 448 lysine anti human epidermal growth factor receptor human mouse monoclonal c225 γ1 chain fusion protein with peptide linker ggggs 2 fusion protein with immunoglobulin anti human epidermal growth factor receptor her3 human clone her3 h3 single chain variable fragment vh ggggs 3 vl complex with human mouse monoclonal c225 κ chain dimer 214 214 222 222 228 228 231 231 octakis thioether with 2s n carboxymethyl 2 3 mercapto 2 5 dioxo 1 pyrrolidinyl β alanylglycylglycyl l phenylalanyl n 1s 2 1s 9s 9 ethyl 5 fluoro 2 3 9 10 13 15 hexahydro 9 hydroxy 4 methyl 10 13 dioxo 1h 12h benzo de pyrano 3 4 6 7 indolizino 1 2 b quinolin 1 yl amino 1 methyl 2 oxoethoxy methyl glycinamide
  • immunoglobulin g1 scfv l kappa dimer anti homo sapiens egfr epidermal growth factor receptor receptor tyrosine protein kinase erbb 1 erbb1 her1 her 1 erbb and anti homo sapiens erbb3 receptor tyrosine protein kinase erbb 3 her3 chimeric and homo sapiens monoclonal antibody tetravalent bispecific conjugated to a camptothecin derivative
  • Immunoglobulin G1-scFv_L-kappa dimer, anti-[Homo sapiens EGFR (epidermal growth factor receptor, receptor tyrosine-protein kinase erbB-1, ERBB1, HER1, HER-1, ERBB)] and anti-[Homo sapiens ERBB3 (receptor tyrosine protein kinase erbB-3, HER3)], chimeric and Homo sapiens monoclonal antibody, tetravalent, bispecific, conjugated to a camptothecin derivative
  • izalontamab brengitecan
  • Izalontamab brengitecan
  • izalontamab brengitecan [INN]
  • IZALONTAMAB BRENGITECAN [USAN]
  • izalontamab brengitecan inn
  • izalontamab brengitecan usan

CAS registry numbers
  • 2760528-47-8
ChEMBL ID
CHEMBL5314841
www.ebi.ac.uk
FDA ingredient codes (UNII)
  • UC2FX6YY3P

First in class
No
Orphan designation
No

Drug name stem
-mab; -tecan

Investigated indications

  • Condition
    Neoplasms
    Highest recorded phase
    2
    Condition identifier
    EFO:0000616
    Subject identifier
    D009369

  • Condition identifier
    EFO_0000616
  • Condition identifier
    MONDO_0005070
  • Condition identifier
    MONDO_0005233
    Highest recorded phase
    2
  • Condition identifier
    MONDO_0005494
    Highest recorded phase
    2
  • Condition identifier
    MONDO_0007254
    Highest recorded phase
    2

Prodrug
No
Chirality
Single enantiomer
Inorganic
No
Natural product
No

  • Component
    Glycosylation sites (N)
    Sequence
    88 $ 88'' $ 299 $ 299''
  • Component
    Heavy chain
    Type
    Protein
    Sequence
    QVQLKQSGPGLVQPSQSLSITCTVSGFSLTNYGVHWVRQSPGKGLEWLGVIWSGGNTDYNTPFTSRLSINKDNSKSQVFFKMNSLQSNDTAIYYCARALTYYDYEFAYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGGGGGSGGGGSQVQLQESGGGLVKPGGSLRLSCAASGFTFSSYWMSWVRQAPGKGLEWVANINRDGSASYYVDSVKGRFTISRDDAKNSLYLQMNSLRAEDTAVYYCARDRGVGYFDLWGRGTLVTVSSGGGGSGGGGSGGGGSQSALTQPASVSGSPGQSITISCTGTSSDVGGYNFVSWYQQHPGKAPKLMIYDVSDRPSGVSDRFSGSKSGNTASLIISGLQADDEADYYCSSYGSSSTHVIFGGGTKVT
  • Component
    Disulfide bridges
    Sequence
    22-95 $ 22''-95'' $ 23'-88' $ 23'''-88''' $ 134'-194' $ 134'''-194''' $ 146-202 $ 146''-202'' $ 222-214' $ 222''-214'''$ 228-228'' $ 231-231'' $ 263-323 $ 263''-323'' $ 369-427 $ 369''-427'' $ 480-554 $ 480''-554'' $ 613-681 $ 613''-681''
  • Component
    Light chain
    Type
    Protein
    Sequence
    DILLTQSPVILSVSPGERVSFSCRASQSIGTNIHWYQQRTNGSPRLLIKYASESISGIPSRFSGSGSGTDFTLSINSVESEDIADYYCQQNNNWPTTFGAGTKLELKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC

Related records

Trials (51)

In development for (1)