Imeroprubart
Highest phase reached
Phase 2
Drug type
Antibody
- Listing at source
- Listed
- Highest phase reached
- Phase 2
- Drug type
- Antibody
- Drug name
- Imeroprubart
- h gamma1 heavy chain homo sapiens 1 451 vh homo sapiens ighv3 23 01 93 9 ighd ighj4 01 93 3 cdr imgt 8 8 14 26 33 51 58 97 110 1 121 homo sapiens ighg1 03 g1m3 ng1m1 ch1 r120 ch3 e12 m14 g1v14 ch2 a1 3 a1 2 ch1 r120 218 122 219 hinge 1 15 220 234 ch2 l1 3 a 238 l1 2 a 239 235 344 ch3 e12 360 m14 362 345 449 chs 450 451 122 451 224 213 disulfide with l lambda2 light chain homo sapiens 1 214 v lambda homo sapiens iglv3 21 02 95 8 iglj2 01 91 7 cdr imgt 6 3 11 26 31 49 51 88 98 1 108 homo sapiens iglc2 01 100 c lambda2 109 214 dimer 230 230 233 233 bisdisulfide produced in chinese hamster ovary cho cells glycoform alfa
- H-gamma1 heavy chain Homo sapiens (1-451) [VH (Homo sapiens IGHV3-23*01 (93.9%) -(IGHD) -IGHJ4*01 (93.3%), CDR-IMGT [8.8.14] (26-33.51-58.97-110)) (1-121) -Homo sapiens IGHG1*03, G1m3, nG1m1 CH1 R120, CH3 E12, M14, G1v14 CH2 A1.3, A1.2 (CH1 R120 (218) (122-219), hinge 1-15 (220-234), CH2 L1.3>A (238), L1.2>A (239) (235-344), CH3 E12 (360), M14 (362) (345-449), CHS (450-451)) (122-451)], (224-213')-disulfide with L-lambda2 light chain Homo sapiens (1'-214') [V-LAMBDA (Homo sapiens IGLV3-21*02 (95.8%) -IGLJ2*01 (91.7%), CDR-IMGT [6.3.11] (26'-31'.49'-51'.88'-98')) (1'-108') -Homo sapiens IGLC2*01 (100%) (C-LAMBDA2) (109'-214')]; dimer (230-230'':233-233'')-bisdisulfide, produced in Chinese hamster ovary (CHO) cells, glycoform alfa
- hl161ans
- HL161ANS
- imeroprubart
- Imeroprubart
- imeroprubart [INN]
- IMEROPRUBART [USAN]
- imeroprubart inn
- imeroprubart usan
- Immunoglobulin G1 [238-alanine,239-alanine], anti-(human FcRn receptor) (human monoclonal HL161ANS γ1-chain), disulfide with human monoclonal HL161ANS λ-chain, dimer
- immunoglobulin g1 238 alanine 239 alanine anti human fcrn receptor human monoclonal hl161ans γ1 chain disulfide with human monoclonal hl161ans λ chain dimer
- immunoglobulin g1 lambda2 anti homo sapiens fcgrt fc fragment of igg receptor and transporter neonatal fc receptor fcrn transmembrane alpha chain of the neonatal receptor homo sapiens monoclonal antibody
- immunoglobulin g1 lambda2 anti homo sapiens fcgrt fc fragment of igg receptor and transporter neonatal fc receptor fcrn transmembrane alpha chain of the neonatal receptor homo sapiens monoclonal antibody h gamma1 heavy chain homo sapiens 1 451 vh homo sapiens ighv3 23 01 93 9 ighd ighj4 01 93 3 cdr imgt 8 8 14 26 33 51 58 97 110 1 121 homo sapiens ighg1 03 g1m3 ng1m1 ch1 r120 ch3 e12 m14 g1v14 ch2 a1 3 a1 2 ch1 r120 218 122 219 hinge 1 15 220 234 ch2 l1 3 a 238 l1 2 a 239 235 344 ch3 e12 360 m14 362 345 449 chs 450 451 122 451 224 213 disulfide with l lambda2 light chain homo sapiens 1 214 v lambda homo sapiens iglv3 21 02 95 8 iglj2 01 91 7 cdr imgt 6 3 11 26 31 49 51 88 98 1 108 homo sapiens iglc2 01 100 c lambda2 109 214 dimer 230 230 233 233 bisdisulfide produced in chinese hamster ovary cho cells glycoform alfa
- immunoglobulin G1-lambda2, anti-[Homo sapiens FCGRT (Fc fragment of IgG receptor and transporter, neonatal Fc receptor, FcRn, transmembrane alpha chain of the neonatal receptor)], Homo sapiens monoclonal antibody;
- Immunoglobulin G1-lambda2, anti-[Homo sapiens FCGRT (Fc fragment of IgG receptor and transporter, neonatal Fc receptor, FcRn, transmembrane alpha chain of the neonatal receptor)], Homo sapiens monoclonal antibody; H-gamma1 heavy chain Homo sapiens (1-451) [VH (Homo sapiens IGHV3-23*01 (93.9%) -(IGHD) -IGHJ4*01 (93.3%), CDR-IMGT [8.8.14] (26-33.51-58.97-110)) (1-121) -Homo sapiens IGHG1*03, G1m3, nG1m1 CH1 R120, CH3 E12, M14, G1v14 CH2 A1.3, A1.2 (CH1 R120 (218) (122-219), hinge 1-15 (220-234), CH2 L1.3>A (238), L1.2>A (239) (235-344), CH3 E12 (360), M14 (362) (345-449), CHS (450-451)) (122-451)], (224-213')-disulfide with L-lambda2 light chain Homo sapiens (1'-214') [V-LAMBDA (Homo sapiens IGLV3-21*02 (95.8%) -IGLJ2*01 (91.7%), CDR-IMGT [6.3.11] (26'-31'.49'-51'.88'-98')) (1'-108') -Homo sapiens IGLC2*01 (100%) (C-LAMBDA2) (109'-214')]; dimer (230-230'':233-233'')-bisdisulfide, produced in Chinese hamster ovary (CHO) cells, glycoform alfa
- imvt 1402
- imvt1402
- IMVT1402
- CAS registry numbers
- 2919582-96-8
- ChEMBL ID
- CHEMBL6068254
- FDA ingredient codes (UNII)
- PBD3BZ3HW6
- First in class
- No
- Orphan designation
- No
- Drug name stem
- -bart
Investigated indications
- Condition
- Autoimmune Diseases
- Highest recorded phase
- 2
- Condition identifier
- EFO:0005809
- Subject identifier
- D001327
- Condition identifier
- EFO_0005809
- Condition identifier
- MONDO_0006702
- Highest recorded phase
- 2
- Condition identifier
- MONDO_0007179
- Condition identifier
- MONDO_0007691
- Highest recorded phase
- 2
- Prodrug
- No
- Chirality
- Single enantiomer
- Inorganic
- No
- Natural product
- No
- Component
- Heavy chain
- Type
- Protein
- Sequence
- EVQLLESGGGLVQPGGSLRLSCAASEFTEGSSVMTWVRQAPGKGLEWVSVISGSGGSTYYADSVKGRFTISRDNSKNTLYLOMNSLRAEDTAVYYCAKTPWWLRSPFFDYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLOSSGLYSLSSVVTVPSSSLGTOTYICNVNHKPSNTKVDKRVEPKSCDKTHTCPPCPAPEAAGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKENWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNOVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWOQGNVFSCSVMHEALHNHYTOKSLSLSPGK
- Component
- Light chain
- Type
- Protein
- Sequence
- SYVLTQPPSVSVAPGQTARITCGGSNIGSTSVHWYQOKPGQAPVLVVHDDSDRPSGIPERFSGSNSGNTATLTISRVEAGDEADYYCQVRDSSSDHVIFGGGTKLTVLGQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPTECS
- Component
- Disulfide bridges
- Sequence
- 22-96 $ 22''-96'' $ 22'-87' $ 22'''-87''' $ 136'-195' $ 136'''-195''' $ 148-204 $ 148''-204'' $ 224-213' $ 224''-213''' $ 230-230'' $ 233-233'' $ 265-325 $ 265''-325'' $ 371-429 $ 371''-429''
- Component
- Glycosylation sites (N)
- Sequence
- 301 $ 301''
Related records
Trials (8)
- A Long-Term Extension Study of IMVT-1402 in Adult Participants With Graves' Disease (GD)
- A Study to Assess the Efficacy, Safety, and Tolerability of IMVT-1402 as Treatment for Adult Participants With Graves' Disease
- A Study to Assess the Efficacy, Safety, and Tolerability of IMVT-1402 as Treatment for Adult Participants With Graves' Disease
- A Study to Assess the Safety, Tolerability, and Efficacy of IMVT-1402 in Participants With Cutaneous Lupus Erythematosus (CLE)
- A Study to Evaluate the Efficacy, Safety, and Tolerability of IMVT-1402 in Adult Participants With Active, Difficult to Treat Rheumatoid Arthritis
- Efficacy and Safety of IMVT-1402 in Adult Participants With Primary Sjogren's Disease With Moderate to Severe Systemic Disease Activity
- Imeroprubart in Adult Participants With Chronic Inflammatory Demyelinating Polyneuropathy (CIDP)
- Study to Assess the Efficacy and Safety of IMVT-1402 in Participants With Mild to Severe Generalized Myasthenia Gravis
In development for (3)
- Autoimmune disease Phase 2
- Chronic inflammatory demyelinating polyradiculoneuropathy Phase 2
- Guillain-Barre syndrome, familial Phase 2