Gimistotug
Highest phase reached
Phase 3
Drug type
Antibody
- Listing at source
- Listed
- Highest phase reached
- Phase 3
- Drug type
- Antibody
- Drug name
- Gimistotug
- bgb a445
- Bgb-a445
- BGB-A445
- bgba445
- BGBA445
- gimistotug
- Gimistotug
- gimistotug [INN]
- gimistotug inn
- h gamma1 heavy chain humanized 1 450 vh homo sapiens ighv1 46 01 84 7 ighd ighj4 01 92 3 l123 t 115 cdr imgt 8 8 13 26 33 51 58 97 109 1 120 homo sapiens ighg1 03v g1m3 g1m17 ng1m1 ch1 k120 ch3 e12 m14 ch1 r120 k 217 121 218 hinge 1 15 219 233 ch2 234 343 ch3 e12 359 m14 361 344 448 chs 449 450 121 450 223 214 disulfide with l kappa light chain humanized 1 214 vkappa homo sapiens igkv1 33 01 87 4 igkj4 01 100 cdr imgt 6 3 9 27 32 50 52 89 97 1 107 homo sapiens igkc 01 100 km3 a45 1 153 v101 191 108 214 dimer 229 229 232 232 bisdisulfide produced in chinese hamster ovary cho cells glycoform alfa
- H-gamma1 heavy chain humanized (1-450) [VH (Homo sapiens IGHV1-46*01 (84.7%) -(IGHD) -IGHJ4*01 (92.3%) L123>T (115), CDR-IMGT [8.8.13] (26-33.51-58.97-109)) (1-120) -Homo sapiens IGHG1*03v, G1m3>G1m17, nG1m1 CH1 K120, CH3 E12, M14 (CH1 R120>K (217) (121-218), hinge 1-15 (219-233), CH2 (234-343), CH3 E12 (359), M14 (361) (344-448), CHS (449-450)) (121-450)], (223-214')-disulfide with L-kappa light chain humanized (1'-214') [VKAPPA (Homo sapiens IGKV1-33*01 (87.4%) -IGKJ4*01 (100%), CDR-IMGT [6.3.9] (27'-32'.50'-52'.89'-97')) (1'-107') -Homo sapiens IGKC*01 (100%), Km3 A45.1 (153'), V101 (191') (108'-214')]; dimer (229-229'':232-232'')-bisdisulfide, produced in Chinese hamster ovary (CHO) cells, glycoform alfa
- immunoglobulin g1 kappa anti homo sapiens tnfrsf4 tumor necrosis factor receptor tnfr superfamily member 4 ox40 cd134 humanized monoclonal antibody
- immunoglobulin G1-kappa, anti-[Homo sapiens TNFRSF4 (tumor necrosis factor receptor (TNFR) superfamily member 4, OX40, CD134)], humanized monoclonal antibody
- CAS registry numbers
- 2768487-95-0
- ChEMBL ID
- CHEMBL6068122
- FDA ingredient codes (UNII)
- PT47RQF9HF
- First in class
- No
- Orphan designation
- No
- Condition
- Carcinoma, Squamous Cell
- Highest recorded phase
- 1
- Condition identifier
- EFO:0000181
- Subject identifier
- D002294
- Condition
- Neoplasms
- Highest recorded phase
- 3
- Condition identifier
- EFO:0000616
- Subject identifier
- D009369
- Condition
- Carcinoma, Non-Small-Cell Lung
- Highest recorded phase
- 2
- Condition identifier
- EFO:0003060
- Subject identifier
- D002289
- Condition
- Nasopharyngeal Neoplasms
- Highest recorded phase
- 1
- Condition identifier
- EFO:0004252
- Subject identifier
- D009303
- Condition
- Neoplasms
- Highest recorded phase
- 3
- Condition identifier
- MONDO:0004992
- Subject identifier
- D009369
- Condition identifier
- EFO_0000616
- Condition identifier
- EFO_0003060
- Highest recorded phase
- 2
- Condition identifier
- MONDO_0004992
- Highest recorded phase
- 3
- Condition identifier
- MONDO_0005070
- Condition identifier
- MONDO_0005086
- Highest recorded phase
- 1
- Condition identifier
- MONDO_0005105
- Highest recorded phase
- 1
- Condition identifier
- MONDO_0005233
- Highest recorded phase
- 2
- Condition identifier
- MONDO_0008903
- Highest recorded phase
- 2
- Condition identifier
- MONDO_0040679
- Highest recorded phase
- 1
- NCT04164199
- NCT04215978
- NCT06029127
- Prodrug
- No
- Chirality
- Single enantiomer
- Inorganic
- No
- Natural product
- No
- Component
- Heavy chain
- Type
- Protein
- Sequence
- QVQLVQSGAEVKKPGSSVKVSCKASGYKFTSYIIHWVRQAPGQGLEWMGYINPYNEGTRYNQKFQGRVTLTADKSTSTAYMELSSLRSEDTAVYYCARGYYGSSYAMDYWGQGTTVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
- Component
- Light chain
- Type
- Protein
- Sequence
- DIQMTQSPSSLSASVGDRVTITCRASQGISNYLNWYQQKPDGAIKLLIYDASTLYSGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQYSKLPYTFGGGTKVEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC
- Component
- Glycosylation sites (N)
- Sequence
- 300 $ 300''
- Component
- Disulfide bridges
- Sequence
- 22-96 $ 22''-96'' $ 23'-88' $ 23'''-88''' $ 134'-194' $ 134'''-194''' $ 147-203 $ 147''-203'' $ 223-214' $ 223''-214''' $ 229-229'' $ 232-232'' $ 264-324 $ 264''-324'' $ 370-428 $ 370''-428''
Related records
Trials (5)
- A Study of Gimistotug (BGB-A445) in Combination With Other Investigational Agents in Participants With Non-Small Cell Lung Cancer
- A Study of Tislelizumab in Combination With Investigational Agents in Participants With Non-Small Cell Lung Cancer
- A Study to Investigate the Antitumor Activity, Safety, Tolerability, and Pharmacokinetics of BGB-A445 in Combination With Tislelizumab in Participants With Select Advanced Solid Tumors.
- Safety and Preliminary Effectiveness of BGB-A445 in Combination With Tislelizumab in Participants With Advanced Solid Tumors
- Study of Tislelizumab, Pamiparib, and Other Investigational Agents in Participants With Advanced Malignancies
In development for (5)
- Cancer Phase 3
- Head and neck squamous cell carcinoma Phase 1
- Nasopharyngeal neoplasm Phase 1
- Neoplasm Phase 3
- Non-small cell lung carcinoma Phase 2