Etentamig
Highest phase reached
Phase 3
Drug type
Antibody
- Listing at source
- Listed
- Highest phase reached
- Phase 3
- Drug type
- Antibody
- Drug name
- Etentamig
- abbv 383
- abbv 383 etentamig
- Abbv-383
- ABBV-383
- ABBV-383 (Etentamig)
- anti bcma anti cd3 t cell engaging bispecific antibody abbv 383
- anti bcma x acd3 t bsab tnb 383b
- Anti-bcma x acd3 t-bsab tnb-383b
- Anti-BCMA/Anti-CD3 T-cell Engaging Bispecific Antibody ABBV-383
- etentamig
- Etentamig
- Etentamig (ABBV-383)
- etentamig [INN]
- ETENTAMIG [USAN]
- Etentamig [WHO-DD]
- etentamig inn
- etentamig usan
- etentamig who dd
- immunoglobulin anti human b cell maturation antigen human monoclonal f1a heavy chain v d j region fusion protein with peptide linker ggggs fusion protein with immunoglobulin anti human b cell maturation antigen human monoclonal f1a heavy chain v d j region fusion protein with immunoglobulin g4 10 proline 16 alanine 17 alanine 148 serine 150 alanine 189 valine 229 de lysine human γ4 chain c terminal fragment 251 229 254 232 bis disulfide with immunoglobulin g4 231 proline 237 alanine 238 alanine 369 tryptophan de 450 lysine anti human cd3 antigen subunit δε complex human monoclonal f2b γ4 chain disulfide with human monoclonal f2b κ chain
- immunoglobulin g4 kappa anti homo sapiens cd3e cd3 epsilon and anti homo sapiens tnfrsf17 tnf receptor superfamily member 17 bcma tnfrsf13a cd269 homo sapiens and humanized monoclonal antibody bispecific trivalent gamma4 heavy chain anti cd3e homo sapiens 1 450 vh homo sapiens ighv3 9 01 100 ighd ighj4 01 100 cdr imgt 8 8 16 26 33 51 58 97 112 1 123 homo sapiens ighg4 01 ng4m a ch2 l92 g4v5 h p10 g4v4 ch2 a1 3 a1 2 g1v32 ch3 w22 knob ch1 124 221 hinge 1 12 s10 p 231 222 233 ch2 f1 3 a 237 l1 2 a 238 l92 312 234 343 ch3 t22 w 369 344 448 chs 449 450 124 450 137 214 disulfide with a fixed kappa light chain homo sapiens 1 214 v kappa homo sapiens igkv3 15 01 100 igkj1 01 100 cdr imgt 6 3 9 27 32 50 52 89 97 1 107 homo sapiens igkc 01 100 km3 a45 1 153 v101 191 108 214 gamma4 heavy chain anti tnfrsf17 humanized bivalent 1 472 vh humanized homo sapiens ighv3 23 01 93 9 ighd ighj1 01 w118 r 109 85 7 cdr imgt 8 8 12 26 33 51 58 97 108 1 119 5 mer tetraglycyl seryl linker 120 124 vh humanized homo sapiens ighv3 23 01 93 9 ighd ighj1 01 w118 r 233 85 7 cdr imgt 8 8 12 150 157 175 182 221 232 125 243 homo sapiens ighg4 01 ng4m a ch2 l92 g4v5 h p10 g4v4 ch2 a1 3 a1 2 g1v33 ch3 s22 a24 v86 hole hinge 1 12 s10 p 253 244 255 ch2 f1 3 a 259 l1 2 a 260 l92 334 256 365 ch3 t22 s 391 l24 a 393 y86 v 432 366 470 chs 471 472 244 472 dimer 229 251 232 254 bisdisulfide produced in chinese hamster ovary cho cells cell line cho k1 glycoform alfa
- immunoglobulin G4-kappa, anti-[Homo sapiens CD3E (CD3 epsilon)] and anti-[Homo sapiens TNFRSF17 (TNF receptor superfamily member 17, BCMA, TNFRSF13A, CD269)], Homo sapiens and humanized monoclonal antibody, bispecific, trivalent; gamma4 heavy chain anti-CD3E Homo sapiens (1-450) [VH (Homo sapiens IGHV3-9*01 (100%) -(IGHD) -IGHJ4*01 (100%), CDR-IMGT [8.8.16] (26-33.51-58.97-112)) (1-123) -Homo sapiens IGHG4*01, nG4m(a) CH2 L92, G4v5 h P10, G4v4 CH2 A1.3, A1.2, G1v32 CH3 W22 (knob) (CH1 (124-221), hinge 1-12 S10>P (231) (222-233), CH2 F1.3>A (237), L1.2>A (238), L92 (312) (234-343), CH3 T22>W (369) (344-448), CHS (449-450)) (124-450)], (137-214')-disulfide with a fixed kappa light chain Homo sapiens (1'-214') [V-KAPPA (Homo sapiens IGKV3-15*01 (100%) -IGKJ1*01 (100%), CDR-IMGT [6.3.9] (27-32.50-52.89-97)) (1'-107') -Homo sapiens IGKC*01 (100%), Km3 A45.1 (153), V101 (191) (108'-214')]; gamma4 heavy chain anti-TNFRSF17 humanized, bivalent (1''-472'') [VH humanized (Homo sapiens IGHV3-23*01 (93.9%) -(IGHD) - IGHJ1*01 W118>R (109) (85.7%), CDR-IMGT [8.8.12] (26-33.51- 58.97-108)) (1''-119'')-5-mer tetraglycyl-seryl linker (120''-124'') -[VH humanized (Homo sapiens IGHV3-23*01 (93.9%) -(IGHD) - IGHJ1*01 W118>R (233) (85.7%), CDR-IMGT [8.8.12] (150- 157.175-182.221-232)) (125''-243'') -Homo sapiens IGHG4*01, nG4m(a) CH2 L92, G4v5 h P10, G4v4 CH2 A1.3, A1.2, G1v33 CH3 S22, A24, V86 (hole) (hinge 1-12 S10>P (253) (244''-255''), CH2 F1.3>A (259), L1.2>A (260), L92 (334) (256''-365''), CH3 T22>S (391), L24>A (393), Y86>V (432) (366''-470''), CHS (471''-472'')) (244''-472'')] ; dimer (229-251'':232-254'')-bisdisulfide, produced in Chinese hamster ovary (CHO) cells, cell line CHO-K1, glycoform alfa
- Immunoglobulin, anti-(human B-cell maturation antigen) (human monoclonal F1A heavy chain V-D-J region) fusion protein with peptide linker (GGGGS) fusion protein with immunoglobulin, anti-(human B-cell maturation antigen) (human monoclonal F1A heavy chain V-D-J region) fusion protein with immunoglobulin G4 [10-proline,16-alanine,17-alanine,148-serine,150-alanine,189-valine,229-de-lysine] (human γ4-chain C-terminal fragment), (251→229′),(254→232′)-bis(disulfide) with immunoglobulin G4 [231-proline,237-alanine,238-alanine,369-tryptophan,de-450-lysine] anti-(human CD3 antigen subunit δε complex) (human monoclonal F2B γ4-chain) disulfide with human monoclonal F2B κ-chain
- tnb 383b
- Tnb-383b
- TNB-383B
- CAS registry numbers
- 2490552-52-6
- ChEMBL ID
- CHEMBL5314973
- FDA ingredient codes (UNII)
- CO86AOP337
- First in class
- No
- Orphan designation
- No
- Drug name stem
- -mig
- Condition
- Neoplasms
- Highest recorded phase
- 2
- Condition identifier
- EFO:0000616
- Subject identifier
- D009369
- Condition
- Multiple Myeloma
- Highest recorded phase
- 3
- Condition identifier
- EFO:0001378
- Subject identifier
- D009101
- Condition
- Amyloidosis, Familial
- Highest recorded phase
- 1
- Condition identifier
- MONDO:0019438
- Subject identifier
- D028226
- Condition identifier
- EFO_0000616
- Condition identifier
- EFO_0001378
- Highest recorded phase
- 3
- Condition identifier
- MONDO_0005070
- Condition identifier
- MONDO_0009693
- Highest recorded phase
- 3
- Condition identifier
- MONDO_0019065
- Highest recorded phase
- 1
- Condition identifier
- MONDO_0019438
- Condition identifier
- MONDO_0100280
- Highest recorded phase
- 1
- NCT03933735
- NCT05259839
- NCT05286229
- NCT05650632
- NCT06158841
- NCT06223516
- NCT06158854
- Prodrug
- No
- Chirality
- Single enantiomer
- Inorganic
- No
- Natural product
- No
- Component
- Glycosylation sites (N)
- Sequence
- 300 $ 322''
- Component
- Disulfide bridges
- Sequence
- 22-96 $ 22''-96'' $ 23'-88' $ 134'-194' $ 137-214' $ 146''-220'' $ 150-206 $ 229-251'' $ 232-254'' $ 264-324 $ 286''-346'' $ 370-428 $ 392''-450''
- Component
- Heavy chain: anti-TNFRSF17, bivalent (H')
- Type
- Protein
- Sequence
- EVQLLESGGGLVQPGGSLRLSCAASGFTVSSYGMSWVRQAPGKGPEWVSGIRGSDGSTYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAKQGENDGPFDHRGQGTLVTVSSGGGGSEVQLLESGGGLVQPGGSLRLSCAASGFTVSSYGMSWVRQAPGKGPEWVSGIRGSDGSTYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAKQGENDGPFDHRGQGTLVTVSSESKYGPPCPPCPAPEAAGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSQEDPEVQFNWYVDGVEVHNAKTKPREEQFNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKGLPSSIEKTISKAKGQPREPQVYTLPPSQEEMTKNQVSLSCAVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLVSRLTVDKSRWQEGNVFSCSVMHEALHNHYTQKSLSLSLGK
- Component
- Heavy chain: H-gamma4 anti-CD3D/CD3E (knob) (H)
- Type
- Protein
- Sequence
- EVQLVESGGGLVQPGRSLRLSCAASGFTFDDYAMHWVRQAPGKGLEWVSGISWNSGSIGYADSVKGRFTISRDNAKNSLYLQMNSLRAEDTALYYCAKDSRGYGDYRLGGAYWGQGTLVTVSSASTKGPSVFPLAPCSRSTSESTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTKTYTCNVDHKPSNTKVDKRVESKYGPPCPPCPAPEAAGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSQEDPEVQFNWYVDGVEVHNAKTKPREEQFNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKGLPSSIEKTISKAKGQPREPQVYTLPPSQEEMTKNQVSLWCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSRLTVDKSRWQEGNVFSCSVMHEALHNHYTQKSLSLSLGK
- Component
- Heavy chain: anti-CD22 G4(VH-h-CH2-CH3) (H'')
- Type
- Protein
- Sequence
- EIVMTQSPATLSVSPGERATLSCRASQSVSSNLAWYQQKPGQAPRLLIYGASTRATGIPARFSGSGSGTEFTLTISSLQSEDFAVYYCQQYNNWPWTFGQGTKVEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC
Related records
Trials (14)
- A Study of TNB-383B in Participants With Relapsed or Refractory Multiple Myeloma
- A Study to Assess A Change in Disease Activity and Adverse Events of Intravenous Etentamig and Daratumumab (Etentamig+D) Compared to Daratumumab, Lenalidomide, and Dexamethasone (DRd) in Adult Participants With Newly Diagnosed Multiple Myeloma Not Eligible for Transplant
- A Study to Assess Adverse Events and Change in Disease Activity of Intravenously (IV) Infused Etentamig (ABBV-383) in Combination With Anti-Cancer Regimens for the Treatment of Adult Participants With Relapsed/Refractory Multiple Myeloma
- A Study to Assess Adverse Events and Change in Disease State of Intravenously (IV) Infused Etentamig (ABBV-383) of Adult Participants With Relapsed or Refractory Multiple Myeloma in Japan
- A Study to Assess Adverse Events of Intravenously (IV) Infused Etentamig (ABBV-383) in Adult Participants With Relapsed or Refractory Multiple Myeloma
- A Study to Assess Change in Disease Activity and Adverse Events (AE)s in Adult Participants With Immunoglobulin Light Chain (AL) Amyloidosis Receiving Etentamig (ABBV-383) as an Intravenous (IV) Infusion
- A Study to Assess Change in Disease Activity and Adverse Events (AE)s in Adult Participants With Multiple Myeloma Receiving T Cell Engaging Bi/Tri-specific Antibodies Intravenously (IV)/Subcutaneously (SC) Alone or in Combinations
- A Study to Evaluate Adverse Events and Change in Disease Activity With Injected Etentamig Plus Oral Pomalidomide Versus Standard Therapies in Adults With Relapsed or Refractory Multiple Myeloma
- ABBV-383 for the Treatment of Relapsed Refractory Waldenström Macroglobulinemia
- Etenta-Isa-VRd in Newly Diagnosed High-Risk Multiple Myeloma
- Expanded Access for TNB-383B in a Subject With Relapsed/Refractory Multiple Myeloma
- Study Assessing Activity of Intravenous (IV) Etentamig Monotherapy Versus Standard Available Therapies in Adult Participants With Relapsed or Refractory Multiple Myeloma
- Study of Intravenously (IV) Infused Etentamig in Combination With an Oral Cereblon E3 Ligase Modulatory Drug (CELMoD) Agent Assessing Adverse Events and Change in Disease Activity in Adult Participants With Relapsed or Refractory Multiple Myeloma
- Study to Evaluate Change in Disease Activity and Adverse Events of Subcutaneous Etentamig Compared With Daratumumab Plus Cyclophosphamide Plus Bortezomib Plus Dexamethasone (Dara-CyBorD) in Adults With Amyloid Light Chain (AL) Amyloidosis
In development for (3)
- AL amyloidosis Phase 1
- Neoplasm Phase 2
- Plasma cell myeloma Phase 3