Efinopegdutide
Highest phase reached
Phase 2
Drug type
Protein
- Listing at source
- Listed
- Highest phase reached
- Phase 2
- Drug type
- Protein
- Drug name
- Efinopegdutide
- (PEG)-BHD1028 Multiple Ascending Dose
- (PEG)-BHD1028 Single Ascending Dose
- 2L Polyethylene Glycol (PEG)
- 4L Polyethylene Glycol (PEG)
- Administration of Polyethylene Glycol (PEG) 4000 as per treatment allocation to participants
- efinopegdutida
- Efinopegdutida
- efinopegdutide
- Efinopegdutide
- efinopegdutide [INN]
- EFINOPEGDUTIDE [USAN]
- efinopegdutide inn
- efinopegdutide usan
- hm 12525a
- HM-12525A
- hm12525a
- HM12525A
- jnj 64565111
- Jnj-64565111
- JNJ-64565111
- laps glp gcg
- LAPS-GLP/GCG
- Oral polyethylene glycol (PEG) based preparation (13-16 years)
- Oral polyethylene glycol (PEG) based preparation (9-12 years)
- oxyntomodulin analogue conjugated by a 10kda polyethylene glycol peg linker n 225 to an fc portion dimer of human immunoglobulin g4 igg4 n1 9 3 omega 3 3 3rs 3 16 20 anhydro s2 b s16 e r17 k q20 k d21 e k30 c human oxyntomodulin 1 30 peptidamide s3 30 yl 2 5 dioxopyrrolidin 1 yl propanamido propoxy polyoxyethylene propyl human immunoglobulin g4 fc fragment 9 229 9 229 dipeptide 11 11 disulfideproduced in escherishia coli
And 10 more, listed on the interactive page.
- CAS registry numbers
- 2055640-93-0
- ChEMBL ID
- CHEMBL4297576
- FDA ingredient codes (UNII)
- DR6P1M58PO
- First in class
- No
- Orphan designation
- No
- Drug name stem
- ef-; -peg-; -tide
- Mechanism
- Glucagon receptor agonist
- Action type
- Agonist
- Target
- Glucagon receptor
- Protein identifier
- P47871
- Mechanism
- Glucagon-like peptide 1 receptor agonist
- Action type
- Agonist
- Target
- Glucagon-like peptide 1 receptor
- Protein identifier
- P43220
- Mechanism
- Glucagon receptor agonist
- Action type
- Agonist
- Target
- Glucagon receptor
- Mechanism
- Glucagon-like peptide 1 receptor agonist
- Action type
- Agonist
- Target
- Glucagon-like peptide 1 receptor
- Condition
- Obesity
- Highest recorded phase
- 2
- Condition identifier
- EFO:0001073
- Subject identifier
- D009765
- Condition
- Non-alcoholic Fatty Liver Disease
- Highest recorded phase
- 2
- Condition identifier
- EFO:0003095
- Subject identifier
- D065626
- Condition
- Non-alcoholic Fatty Liver Disease
- Highest recorded phase
- 2
- Condition identifier
- EFO:1001249
- Subject identifier
- D065626
- Condition
- Diabetes Mellitus, Type 2
- Highest recorded phase
- 1
- Condition identifier
- MONDO:0005148
- Subject identifier
- D003924
- Condition
- Kidney Failure, Chronic
- Highest recorded phase
- 1
- Condition identifier
- MONDO:0024327
- Subject identifier
- D007676
- Condition identifier
- EFO_0001073
- Highest recorded phase
- 2
- Condition identifier
- EFO_0003095
- Highest recorded phase
- 2
- Condition identifier
- EFO_1001249
- Highest recorded phase
- 2
- Condition identifier
- HP_0001513
- Highest recorded phase
- 2
- Condition identifier
- MONDO_0005148
- Highest recorded phase
- 2
- Condition identifier
- MONDO_0007027
- Highest recorded phase
- 2
- Condition identifier
- MONDO_0011122
- Highest recorded phase
- 2
- Condition identifier
- MONDO_0013209
- Highest recorded phase
- 2
- Condition identifier
- MONDO_0024327
- Highest recorded phase
- 1
- NCT02862431
- NCT03235219
- NCT03486392
- NCT03586843
- NCT03546205
- NCT04944992
- NCT06052566
- NCT06465186
- Prodrug
- No
- Chirality
- Single enantiomer
- Inorganic
- No
- Natural product
- No
- Component
- Disulfide bridges
- Sequence
- 11-11' $ 43-103 $ 43'-103' $ 149-207 $ 149'-207'
- Component
- Sequence: monomer
- Type
- Protein
- Sequence
- PSCPAPEFLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSQEDPEVQFNWYVDGVEVHNAKTKPREEQFNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKGLPSSIEKTISKAKGQPREPQVYTLPPSQEEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSRLTVDKSRWQEGNVFSCSVMHEALHNHYTQKSLSLSLGK
Related records
Trials (58)
- A Clinical Study of Efinopegdutide (MK-6024) in Healthy Chinese Volunteers (MK-6024-011)
- A Clinical Study of Efinopegdutide in Participants With Precirrhotic Nonalcoholic Steatohepatitis (NASH) (MK-6024-013)
- A Clinical Study of Efinopegdutide in People With Compensated Cirrhosis Due to Steatohepatitis (MK-6024-017)
- A Phase 1b Study to Assess Safety, Tolerability, Pharmacokinetics and Pharmacodynamics of Multiple Doses of JNJ-64565111 in Participants With Type 2 Diabetes Mellitus
- A Study of Efinopegdutide (MK-6024) in Participants With Nonalcoholic Fatty Liver Disease (NAFLD) (MK-6024-001)
- A Study of Efinopegdutide in Healthy Obese Participants (MK-6024-015)
- A Study of Efinopegdutide in Participants With Hepatic Impairment (MK-6024-014)
- A Study of JNJ-64565111 After Single Subcutaneous Administration at Different Injection Sites in Otherwise Healthy Overweight/Obese Adult Participants and a Study of JNJ-6456511 in Otherwise Healthy Obese Adult Participants After Multiple Dose
- A Study to Assess the Safety, Tolerability and Pharmacokinetics of Subcutaneous (SC) Injections of JNJ-64565111 in Healthy Male Japanese Participants and to Assess Pharmacokinetics Following Subcutaneous Injections of JNJ-64565111 in Healthy Male Caucasian Participants
- A Study to Evaluate JNJ-64565111 Pharmacokinetics and Safety in Adult Participants With Varying Degrees of Renal Function
- A Study to Evaluate the Safety and Efficacy of JNJ-64565111 in Non-diabetic Severely Obese Participants
- A Study to Evaluate the Safety and Efficacy of JNJ-64565111 in Severely Obese Participants With Type 2 Diabetes Mellitus
- A Study to Investigate the Effect of JNJ-64565111 on Cardiac Repolarization (Corrected QT Interval) Compared With Placebo in Healthy Adults: a Thorough ECG Study Employing Placebo, JNJ-64565111, and a Positive Control (Moxifloxacin)
- Alternate Dosing Study of MK-6024 in Adults With Metabolic Dysfunction-Associated Steatotic Liver Disease (MASLD) (MK-6024-016)
- Clinical Study of PEG Bowel Preparation in Appendectomy Patients
- Combination of Lactulose and Polyethylene Glycol Electrolytes Powder (PEG-ELS) for Bowel Preparation in Type II Diabetes Mellitus Patients
- Combination of Mitoxantrone Liposome and Etoposide, Dexamethasone, Pegaspargase and Golidocitinib (MEPL-G) in the Treatment of NK/T-cell Lymphoma Associated Hemophagocytic Lymphohistiocytosis (NKTCL-HLH)
- Compare Polyethylene Glycol and Sodium Picosulfate Alone or Combined
- Comparison Between 3-L and 4-L Polyethylene Glycol in Bowel Preparation
- Comparison of Bowel Cleansing Regimens Prior to Colonoscopy
In development for (5)
- Chronic renal failure syndrome Phase 1
- Metabolic dysfunction-associated steatohepatitis Phase 2
- Metabolic dysfunction-associated steatotic liver disease Phase 2
- Obesity disorder Phase 2
- Type 2 diabetes mellitus Phase 1