Domvanalimab
Highest phase reached
Phase 3
Drug type
Antibody
- Listing at source
- Listed
- Highest phase reached
- Phase 3
- Drug type
- Antibody
- Drug name
- Domvanalimab
- ab 154
- AB-154
- ab154
- Ab154
- AB154
- domvanalimab
- Domvanalimab
- DOMVANALIMAB
- Domvanalimab (DOM)
- domvanalimab [INN]
- DOMVANALIMAB [USAN]
- Domvanalimab [WHO-DD]
- domvanalimab inn
- domvanalimab usan
- domvanalimab who dd
- Immunoglobulin G1 [236-alanine,237-alanine,de-C-terminal-lysine], anti-(human receptor TIGIT)(human-Mus musculus monoclonal AB154 γ1-chain), disulfide with human-Mus musculus monoclonal AB154 κ-chain, dimer
- immunoglobulin g1 236 alanine 237 alanine de c terminal lysine anti human receptor tigit human mus musculus monoclonal ab154 γ1 chain disulfide with human mus musculus monoclonal ab154 κ chain dimer
- immunoglobulin g1 kappa anti homo sapiens tigit t cell immunoreceptor with ig domain and itim v set ig member 9 vsig9 v set and transmembrane member 3 vstm3 humanized monoclonal antibody gamma1 heavy chain humanized 1 448 vh homo sapiens ighv3 48 01 90 8 ighd ighj4 01 92 3 cdr imgt 8 8 12 26 33 51 58 97 108 1 119 homo sapiens ighg1 01 g1m17 1 g1v14 ch2 a1 3 a1 2 ch1 k120 216 120 217 hinge 1 15 218 232 ch2 l1 3 a 236 l1 2 a 237 233 342 ch3 d12 358 l14 360 343 447 chs k del 448 120 448 222 214 disulfide with kappa light chain humanized 1 214 v kappa homo sapiens igkv1 16 01 89 5 igkj4 01 100 cdr imgt 6 3 9 27 32 50 52 89 97 1 107 homo sapiens igkc 01 100 km3 a45 1 153 v101 191 108 214 dimer 228 228 231 231 bisdisulfide produced in a chinese hamster ovary cho k1 cell line glycoform alfa
- immunoglobulin G1-kappa, anti-[Homo sapiens TIGIT (T-cell immunoreceptor with Ig domain and ITIM, V-set Ig member 9, VSIG9, V-set and transmembrane member 3, VSTM3)], humanized monoclonal antibody; gamma1 heavy chain humanized (1-448) [VH (Homo sapiens IGHV3-48*01 (90.8%) -(IGHD) -IGHJ4*01 (92.3%)) CDR-IMGT [8.8.12] (26-33.51-58.97-108) (1-119) -Homo sapiens IGHG1*01, G1m17,1, G1v14 CH2 A1.3, A1.2 (CH1 K120 (216) (120-217), hinge 1-15 (218-232), CH2 L1.3>A (236), L1.2>A (237) (233-342), CH3 D12 (358), L14 (360) (343-447), CHS K>del (448)) (120-448)], (222-214')-disulfide with kappa light chain humanized (1'-214') [V-KAPPA (Homo sapiens IGKV1-16*01 (89.5%) -IGKJ4*01 (100%)) CDR-IMGT [6.3.9] (27-32.50-52.89-97) (1'-107') -Homo sapiens IGKC*01 (100%) Km3 A45.1 (153), V101 (191) (108'-214')]; dimer (228-228'':231-231'')-bisdisulfide, produced in a Chinese hamster ovary (CHO)-K1 cell line, glycoform alfa
- CAS registry numbers
- 2368219-35-4
- ChEMBL ID
- CHEMBL4650392
- FDA ingredient codes (UNII)
- 45X7OU8C4J
- First in class
- No
- Orphan designation
- No
- Pharmacology name
- domvanalimab
- Type
- Antibody
- Drug name stem
- -mab
- Action
- Binding
- Action type
- Binding
- Target
- TIGIT
- Gene symbol
- TIGIT
- Protein identifier
- Q495A1
- Mechanism
- T-cell immunoreceptor with Ig and ITIM domains inhibitor
- Action type
- Inhibitor
- Target
- T-cell immunoreceptor with Ig and ITIM domains
- Protein identifier
- Q495A1
Open Targets mechanisms
- Mechanism
- T-cell immunoreceptor with Ig and ITIM domains inhibitor
- Action type
- Inhibitor
- Target
- T-cell immunoreceptor with Ig and ITIM domains
- Condition
- Immunotherapy
- Highest recorded phase
- 1
- Subject identifier
- D007167
- Condition
- Adenocarcinoma
- Highest recorded phase
- 3
- Condition identifier
- EFO:0000228
- Subject identifier
- D000230
- Condition
- Glioblastoma
- Highest recorded phase
- 0.5
- Condition identifier
- EFO:0000519
- Subject identifier
- D005909
- Condition
- Neoplasms
- Highest recorded phase
- 2
- Condition identifier
- EFO:0000616
- Subject identifier
- D009369
- Condition
- Melanoma
- Highest recorded phase
- 2
- Condition identifier
- EFO:0000756
- Subject identifier
- D008545
- Condition
- Pancreatic Neoplasms
- Highest recorded phase
- 1
- Condition identifier
- EFO:0002618
- Subject identifier
- D010190
- Condition
- Carcinoma, Non-Small-Cell Lung
- Highest recorded phase
- 3
- Condition identifier
- EFO:0003060
- Subject identifier
- D002289
- Condition
- Urinary Bladder Neoplasms
- Highest recorded phase
- 2
- Condition identifier
- MONDO:0004986
- Subject identifier
- D001749
- Condition
- Neoplasms
- Highest recorded phase
- 2
- Condition identifier
- MONDO:0004992
- Subject identifier
- D009369
- Condition
- Carcinoma, Non-Small-Cell Lung
- Highest recorded phase
- 3
- Condition identifier
- MONDO:0005233
- Subject identifier
- D002289
- Condition identifier
- EFO_0000228
- Highest recorded phase
- 3
- Condition identifier
- EFO_0000519
- Condition identifier
- EFO_0000616
- Highest recorded phase
- 1
- Condition identifier
- EFO_0000756
- Highest recorded phase
- 2
- Condition identifier
- EFO_0003060
- Highest recorded phase
- 3
- Condition identifier
- MONDO_0000386
- Highest recorded phase
- 2
- Condition identifier
- MONDO_0002120
- Highest recorded phase
- 2
- Condition identifier
- MONDO_0003219
- Highest recorded phase
- 3
- Condition identifier
- MONDO_0004986
- Highest recorded phase
- 2
- Condition identifier
- MONDO_0005028
- Highest recorded phase
- 3
- Condition identifier
- MONDO_0005036
- Highest recorded phase
- 3
- Condition identifier
- MONDO_0005070
- Condition identifier
- MONDO_0005105
- Highest recorded phase
- 2
- Condition identifier
- MONDO_0005192
- Highest recorded phase
- 1
- Condition identifier
- MONDO_0005233
- Highest recorded phase
- 3
- Condition identifier
- MONDO_0005494
- Highest recorded phase
- 2
- Condition identifier
- MONDO_0006362
- Highest recorded phase
- 2
- Condition identifier
- MONDO_0006451
- Highest recorded phase
- 2
- Condition identifier
- MONDO_0006456
- Highest recorded phase
- 2
- Condition identifier
- MONDO_0007256
- Highest recorded phase
- 2
- Condition identifier
- MONDO_0010150
- Highest recorded phase
- 2
- Condition identifier
- MONDO_0015075
- Highest recorded phase
- 2
- Condition identifier
- MONDO_0018177
- Highest recorded phase
- 1
- Condition identifier
- MONDO_0018944
- Highest recorded phase
- 2
Reported adverse events
- Event
- dysphagia
- Reports
- 4
- Reporting signal score
- 16.6321
- NCT03547973
- NCT05329766
- NCT03628677
- NCT04262856
- NCT04791839
- NCT05211895
- NCT05502237
- NCT05633667
- NCT04656535
- NCT05130177
- NCT05419479
- NCT05568095
- NCT05676931
- NCT06133517
- Prodrug
- No
- Chirality
- Single enantiomer
- Inorganic
- No
- Natural product
- No
- Component
- Heavy chain
- Type
- Protein
- Sequence
- EVQLVESGGGLVQPGGSLRLSCAASGFTFSNFGMHWVRQAPGKGLEWVAFISSGSSSIYYADTVKGRFTISRDNAKNSLYLQMNSLRAEDTAVYYCARMRLDYYAMDYWGQGTMVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPEAAGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPG
- Component
- Glycosylation sites (N)
- Sequence
- 299 $ 299''''
- Component
- Light chain
- Type
- Protein
- Sequence
- DIQMTQSPSSLSASVGDRVTITCRASKSISKYLAWYQQKPGKAPKLLIYSGSTLQSGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQHNEYPWTFGGGTKVEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC
- Component
- Disulfide bridges
- Sequence
- 22-96 $ 22''-96'' $ 23'-88' $ 23'''-88''' $ 134'-194' $ 134'''-194''' $ 146-202 $ 146''-202'' $ 222-214' $ 222''-214''' $ 228-228'' $ 231-231'' $ 263-323 $ 263''-323'' $ 369-427 $ 369''-427''
- Component
- Glycosylation sites (N)
- Sequence
- 299 $ 299''
Related records
Trials (23)
- A Clinical Trial of a New Combination Treatment, Domvanalimab and Zimberelimab, Plus Chemotherapy, for People With an Upper Gastrointestinal Tract Cancer That Cannot be Removed With Surgery That Has Spread to Other Parts of the Body
- A Global Study to Assess the Effects of Durvalumab + Domvanalimab Following Concurrent Chemoradiation in Participants With Stage III Unresectable NSCLC
- A Safety and Efficacy Study of Treatment Combinations With and Without Chemotherapy in Adult Participants With Advanced Upper Gastrointestinal Tract Malignancies
- A Study to Evaluate the Safety and Tolerability of AB154 in Participants With Advanced Malignancies
- AB122 Platform Study
- AB154 Combined With AB122 for Recurrent Glioblastoma
- Domvanalimab and Zimberelimab in Advanced Liver Cancers
- IMMUNORARE5: A National Platform of 5 Academic Phase II Trials Coordinated by Lyon University Hospital to Assess the Safety and the Efficacy of the IMMUNOtherapy With Domvanalimab + Zimberelimab Combination in Patients With Advanced RARE Cancers
- PeRioperative Immunotherapy Combined With Sacituzumab Govitecan in Muscle Invasive blAdder Cancer
- Phase II Trial Evaluating the Safety and Efficacy of the Combination of Zimberelimab, Domvanalimab and Sacituzumab Govitecan as 1L Therapy for PD-L1 Positive Advanced TNBC
- Safety and Efficacy of Zimberelimab (AB122) in Combination With Domvanalimab (AB154) and Etrumadenant (AB928) in Patients With Previously Treated Non-Small Cell Lung Cancer
- Study Evaluating Effectiveness and Safety of Zimberelimab and Domvanalimab in Lung Cancer
- Study of Novel Treatment Combination Therapies in Participants With Head and Neck Squamous Cell Carcinoma Regardless of PD-L1 Expression Status; Substudy-01
- Study of Novel Treatment Combinations in Patients With Lung Cancer
- Study of Sacituzumab Govitecan in Participants With Urothelial Cancer That Cannot Be Removed or Has Spread
- Study to Evaluate Monotherapy and Combination Immunotherapies in Participants With PD-L1 Positive Non-small Cell Lung Cancer
- Study With Various Immunotherapy Treatments in Participants With Lung Cancer
- Switch Maintenance in Pancreatic
- Trial of FOLFIRI + Zimberelimab + Domvanalimab vs FOLFIRI With a Hybrid Synthetic Control Arm in Second Line Treatment of Neuroendocrine Carcinoma of Gastro-enteropancreatic or Unknown Origin (REWENEC 01)
- Zimberelimab (AB122) With TIGIT Inhibitor Domvanalimab (AB154) in PD-1 Relapsed/Refractory Melanoma
In development for (8)
- Adenocarcinoma Phase 3
- Cancer Phase 2
- Exocrine pancreatic carcinoma Phase 1
- Glioblastoma Early phase 1
- Melanoma Phase 2
- Neoplasm Phase 2
- Non-small cell lung carcinoma Phase 3
- Urinary bladder carcinoma Phase 2
Targets (1)
- TIGIT T-cell immunoreceptor with Ig and ITIM domains inhibitor