Denrakibart
Highest phase reached
Phase 2
Drug type
Antibody
- Listing at source
- Listed
- Highest phase reached
- Phase 2
- Drug type
- Antibody
- Drug name
- Denrakibart
- denrakibart
- Denrakibart
- denrakibart [INN]
- denrakibart inn
- gsk 3858279
- GSK-3858279
- gsk3858279
- Gsk3858279
- GSK3858279
- GSK3858279 IV
- h gamma2 heavy chain homo sapiens 1 447 vh homo sapiens ighv5 51 01 98 0 ighd ighj4 01 100 cdr imgt 8 8 14 26 33 51 58 97 110 1 121 homo sapiens ighg2 01 g2m ch2 v45 1 g2v3 ch2 a1 2 a1 s2 a30 l92 s115 s116 ch1 p92 t 193 122 219 hinge 1 12 220 231 ch2 v1 2 a 235 g1 a 237 p2 s 238 h30 a 268 v45 1 282 v92 l 309 a115 s 330 p116 s 331 232 340 ch3 341 445 chs 446 447 341 447 135 220 disulfide with l kappa light chain homo sapiens 1 220 v kappa homo sapiens igkv4 1 01 92 1 igkj1 01 100 cdr imgt 12 3 9 27 38 56 58 95 103 1 113 homo sapiens igkc 01 100 km3 a45 1 v101 c kappa a45 1 159 v101 197 114 220 dimer 223 223 224 224 227 227 230 230 tetrakisdisulfide produced in chinese hamster ovary cho cells cell line cho k1sv glycoform alfa
- H-gamma2 heavy chain Homo sapiens (1-447) [VH (Homo sapiens IGHV5-51*01 (98.0%) -(IGHD) -IGHJ4*01 (100%), CDR-IMGT [8.8.14] (26-33.51-58.97-110)) (1-121) -Homo sapiens IGHG2*01 G2m.. CH2 V45.1, G2v3 CH2 A1.2, A1, S2, A30, L92, S115, S116 (CH1 P92>T (193) (122-219), hinge 1-12 (220-231), CH2 V1.2>A (235), G1>A (237), P2>S (238), H30>A (268), V45.1 (282), V92>L (309), A115>S (330), P116>S(331) (232-340), CH3 (341-445), CHS (446-447)) (341-447)], (135-220')-disulfide with L-kappa light chain Homo sapiens (1'-220') [V-KAPPA (Homo sapiens IGKV4-1*01 (92.1%) -IGKJ1*01 (100%), CDR-IMGT [12.3.9] (27'-38'.56'-58'.95'-103')) (1'-113') -Homo sapiens IGKC*01 (100%) Km3 A45.1, V101 (C-KAPPA A45.1 (159'), V101 (197')) (114'-220')]; dimer (223-223'':224-224'':227-227'':230-230'')-tetrakisdisulfide, produced in Chinese hamster ovary (CHO) cells, cell line CHO-K1SV, glycoform alfa
- immunoglobulin g2 anti human cc chemokine ccl17 recombinant human monoclonal gsk3858279 γ2 chain disulfide with recombinant human monoclonal gsk3858279 κ chain dimer
- immunoglobulin g2 kappa anti homo sapiens ccl17 c c motif chemokine ligand 17 chemokine c c motif ligand 17 small inducible cytokine subfamily a cys cys member 17 scya17 thymus and activation regulated chemokine tarc homo sapiens monoclonal antibody
- immunoglobulin G2-kappa, anti-[Homo sapiens CCL17 (C-C motif chemokine ligand 17, chemokine (C-C motif) ligand 17, small inducible cytokine subfamily A (Cys-Cys) member 17, SCYA17, thymus and activation-regulated chemokine, TARC)], Homo sapiens monoclonal antibody
- Immunoglobulin G2, anti-(human CC chemokine CCL17) (recombinant human monoclonal GSK3858279 γ2-chain), disulfide with recombinant human monoclonal GSK3858279 κ-chain, dimer
- CAS registry numbers
- 2922866-66-6
- ChEMBL ID
- CHEMBL6068232
- FDA ingredient codes (UNII)
- 4K7FCQ266Q
- First in class
- No
- Orphan designation
- No
- Drug name stem
- -bart
- Condition
- Pain
- Highest recorded phase
- 2
- Condition identifier
- EFO:0003843
- Subject identifier
- D010146
- Condition
- Inflammation
- Highest recorded phase
- 2
- Condition identifier
- MP:0001845
- Subject identifier
- D007249
- Condition identifier
- HP_0012531
- Highest recorded phase
- 2
- Condition identifier
- MONDO_0005416
- Highest recorded phase
- 1
- Condition identifier
- MP_0001845
- NCT04114656
- NCT05174013
- NCT05838742
- NCT05838755
- Prodrug
- No
- Chirality
- Single enantiomer
- Inorganic
- No
- Natural product
- No
- Component
- Heavy chain
- Type
- Protein
- Sequence
- EVQLVQSGAEVKKPGESLKISCKGSGYSFTSYWIGWVRQMPGKGLEWMGIIDPSDSDTRYSPSFQGQVTISADKSISTAYLQWSSLKASDTAMYYCARVGPADVWDAFDYWGQGTLVTVSSASTKGPSVFPLAPCSRSTSESTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVTSSNFGTQTYTCNVDHKPSNTKVDKTVERKCCVECPPCPAPPAAASSVFLEPPKPKDTLMISRTPEVTCVVVDVSAEDPEVQFNWYVDGVEVHNAKTKPREBQFNSTERVVSVLTVLHQDWLNGKEYKCKVSNKGLPSSIEKTISKTKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPMLDSDGSFFLYSKLTVDKSRWQQGNVESCSVMHEALHNHYTQKSLSLSPGK
- Component
- Disulfide bridges
- Sequence
- 22-96 $ 22''-96'' $ 23'-94' $ 23'''-94''' $ 135-220' $ 135''-220''' $ 140'200' $ 140'''-200''' $ 148-204 $ 148''-204'' $ 223-223'' $ 223-135'' $ 223''-220'''$224-135 $ 224-224'' $ 224''-220' $ 227-227'' $ 230-230'' $ 261-321 $ 261''-321'' $ 367-425 $ 367''-425''
- Component
- Light chain
- Type
- Protein
- Sequence
- DIVMTQSPDSLAVSLGERATINCKSSQSVLLSFDNINKLAWYQQQKPGQPPKLLIYDASTRESGVPDRFSGSGSGTDFTLTISSLQAEDVAVYYCQQQFYSVPSTFGQGTKVEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLUNNFYPREAKVQWKVDNALQSGNSQESVTFQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSENRGEC
- Component
- Glycosylation sites (N)
- Sequence
- 297 $ 297''
Related records
Trials (5)
- A Dose-Finding Study to Evaluate the Efficacy and Safety of GSK3858279 in Adults With Knee Osteoarthritis (OA) Pain
- A Safety, Tolerability, Pharmacokinetics (PK) and Target Engagement (TE) Study of GSK3858279 in Healthy Participants and Evaluation of the Efficacy of Repeat Doses in Participants With Osteoarthritis (OA)
- A Study to Evaluate Efficacy and Safety of GSK3858279 in Diabetic Peripheral Neuropathic Pain
- Effects of Intravenous GSK3858279 on a Battery of Evoked Pain Tests in Healthy Volunteers
- Safety, Tolerability, Pharmacokinetics and Target Engagement of GSK3858279 in Healthy Caucasian, Chinese and Japanese Participants