Danvilostomig
Highest phase reached
Phase 2
Drug type
Antibody
- Listing at source
- Listed
- Highest phase reached
- Phase 2
- Drug type
- Antibody
- Drug name
- Danvilostomig
- danvilostomig
- Danvilostomig
- danvilostomig [INN]
- danvilostomig inn
- Immunoglobulin G1 [235-alanine,236-alanine,238-alanine,322-alanine,de-448-lysine], bispecific, anti-(human cytotoxic T-lymphocyte-associated protein 4) (human monoclonal MDX010 γ1-chain) fusion protein with peptide linker (GGGGS)2 fusion protein with immunoglobulin anti-(human programmed cell death protein 1) (human-Oryctolagus cuniculus clone PD224D1 single-chain variable fragment VH-(GGGGS)4-VL), disulfide with human monoclonal MDX010 κ-chain, dimer
- immunoglobulin g1 235 alanine 236 alanine 238 alanine 322 alanine de 448 lysine bispecific anti human cytotoxic t lymphocyte associated protein 4 human monoclonal mdx010 γ1 chain fusion protein with peptide linker ggggs 2 fusion protein with immunoglobulin anti human programmed cell death protein 1 human oryctolagus cuniculus clone pd224d1 single chain variable fragment vh ggggs 4 vl disulfide with human monoclonal mdx010 κ chain dimer
- immunoglobulin g1 kappa scfv anti homo sapiens ctla4 cytotoxic t lymphocyte associated antigen 4 cytotoxic t lymphocyte associated protein 4 ctla 4 cd152 each heavy chain being fused to a scfv anti homo sapiens pdcd1 programmed cell death 1 pd1 pd 1 cd279 homo sapiens and humanized monoclonal antibody tetravalent bispecific gamma1 heavy chain anti ctla4 homo sapiens fused to scfv anti pdcd1 humanized 1 701 gamma1 heavy chain anti ctla4 homo sapiens 1 447 vh homo sapiens ighv3 30 01 94 9 ighd ighj4 01 100 cdr imgt 8 8 11 26 33 51 58 97 107 1 118 homo sapiens ighg1 01v g1m17 1 g1m3 1 g1v14 1 ch2 a1 3 a1 2 a1 g1v20 ch2 a105 ch1 k120 r 215 119 216 hinge 1 15 217 231 ch2 l1 3 a 235 l1 2 a 236 g1 a 238 k105 a 323 232 341 ch3 d12 357 l14 359 342 446 chs 447 119 447 10 mer bis tetraglycyl seryl linker 448 457 scfv vh v kappa anti pdcd1 458 701 vh homo sapiens ghv3 64 04 76 5 ighd ighj4 01 86 7 cdr imgt 8 7 9 483 490 508 514 553 561 458 572 20 mer tetrakis tetraglycyl seryl linker 573 592 v kappa homo sapiens igkv1 27 01 88 0 igkj4 01 100 cdr imgt 6 3 11 619 624 642 644 681 691 593 701 221 215 disulfide with kappa light chain anti ctla4 homo sapiens 1 215 v kappa homo sapiens igkv3 20 01 97 9 igkj1 01 100 cdr imgt 7 3 9 27 33 51 53 90 98 1 108 homo sapiens igkc 01 100 km3 a45 1 154 v101 192 109 215 dimer 227 227 230 230 bisdisulfide produced in chinese hamster ovary cho cells glycoform alfa
- immunoglobulin G1-kappa_scFv, anti-[Homo sapiens CTLA4 (cytotoxic T-lymphocyte-associated antigen 4, cytotoxic T-lymphocyte-associated protein 4, CTLA-4, CD152)], each heavy chain being fused to a scFv anti-[Homo sapiens PDCD1 (programmed cell death 1, PD1, PD-1, CD279)], Homo sapiens and humanized monoclonal antibody, tetravalent, bispecific, gamma1 heavy chain anti-CTLA4 Homo sapiens fused to scFv anti-PDCD1 humanized (1-701)[gamma1 heavy chain anti-CTLA4 Homo sapiens (1-447)[VH (Homo sapiens IGHV3-30*01 (94.9%)-(IGHD)-IGHJ4*01 (100%), CDR-IMGT [8.8.11] (26-33.51-58.97-107))(1-118)-Homo sapiens IGHG1*01v, G1m17,1>G1m3,1, G1v14-1 CH2 A1.3, A1.2, A1, G1v20 CH2 A105 (CH1 K120>R(215)(119-216), hinge 1-15 (217-231), CH2 L1.3>A (235), L1.2>A(236), G1>A (238), K105>A (323)(232-341), CH3 D12 (357), L14(359)(342-446), CHS (447))(119-447)] -10-mer bis(tetraglycyl-seryl)linker (448-457)-scFv-VH-V-KAPPA anti-PDCD1 (458-701)[VH (Homo sapiens GHV3-64*04 (76.5%)-(IGHD)-IGHJ4*01(86.7%), CDR-IMGT [8.7.9] (483-490.508-514.553-561))(458-572)-20-mer tetrakis(tetraglycyl-seryl)linker (573-592)-V-KAPPA(Homo sapiens IGKV1-27*01 (88.0%)-IGKJ4*01 (100%), CDR-IMGT [6.3.11] (619-624.642-644.681-691))(593-701)], (221-215')-disulfide with kappa light chain anti-CTLA4 Homo sapiens (1'-215')[V-KAPPA (Homo sapiens IGKV3-20*01(97.9%)-IGKJ1*01(100%), CDR-IMGT [7.3.9] (27-33.51-53.90-98))(1'-108')-Homo sapiens IGKC*01 (100%), Km3 A45.1 (154), V101 (192)(109'-215')], dimer (227-227'':230-230'')-bisdisulfide, produced in Chinese hamster ovary (CHO)cells, glycoform alfa
- si b003
- CAS registry numbers
- 2599198-80-6
- ChEMBL ID
- CHEMBL5314666
- FDA ingredient codes (UNII)
- B4Q67YX49Q
- First in class
- No
- Orphan designation
- No
- Drug name stem
- -mig
Investigated indications
- Condition
- Neoplasms
- Highest recorded phase
- 2
- Condition identifier
- EFO:0000616
- Subject identifier
- D009369
- Condition identifier
- EFO_0000616
- Condition identifier
- MONDO_0005070
- Prodrug
- No
- Chirality
- Single enantiomer
- Inorganic
- No
- Natural product
- No
- Component
- Heavy chain
- Type
- Protein
- Sequence
- QVQLVESGGGVVQPGRSLRLSCAASGFTFSSYTMHWVRQAPGKGLEWVTFISYDGNNKYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAIYYCARTGWLGPFDYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPKSCDKTHTCPPCPAPEAAGAPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCAVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGGGGGSGGGGSEVQLVESGGGLVQPGGSLRLSCTASGFSLSSYAMSWVRQAPGKGLEYIGYIGDTTGIAYASWANGRFTISKDNTKNTVDLQMNSLRAEDTAVYYCARGWSYLDIWGQGTLVTVSSGGGGSGGGGSGGGGSGGGGSALVMTQSPSSLSASVGDRVTITCQASQNIYSNLAWYQQKPGKVPKLLIYQASTLASGVPSRFSGSGYGTDFTLTISSLQPEDVATYYCQGGYYSAALNTFGGGTKVEIK
- Component
- Disulfide bridges
- Sequence
- 22-96 $ 22''-96'' $ 23'-89' $ 23'''-89''' $ 135'-195' $ 135'''-195''' $ 145-201 $ 145''-201'' $ 221-215' $ 221''-215''' $ 227-227'' $ 230-230 $ 262-322 $ 262''-322'' $ 368-426 $ 368''-426'' $ 479-552 $ 479''-552'' $ 615-680 $ 615''-680''
- Component
- Light chain
- Type
- Protein
- Sequence
- EIVLTQSPGTLSLSPGERATLSCRASQSVGSSYLAWYQQKPGQAPRLLIYGAFSRATGIPDRFSGSGSGTDFTLTISRLEPEDFAVYYCQQYGSSPWTFGQGTKVEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC
- Component
- Glycosylation sites (N)
- Sequence
- 298 $ 298''
Related records
Trials (11)
- A Study of BL-B01D1, SI-B003 and BL-B01D1+SI-B003 in Patients With Extensive Stage Small Cell Lung Cancer
- A Study of BL-B01D1, SI-B003 and BL-B01D1+SI-B003 in Patients With Recurrent or Metastatic Cervical Cancer and Other Gynecological Malignancies
- A Study of BL-B01D1, SI-B003 and BL-B01D1+SI-B003 in Patients With Recurrent or Metastatic Head and Neck Squamous Cell Carcinoma and Other Solid Tumors
- A Study of SI-B001+SI-B003 Combined With Platinum-based Chemotherapy as First-line Treatment in Patients With Recurrent or Metastatic Head and Neck Squamous Cell Carcinoma
- A Study of SI-B001+SI-B003± Chemotherapy in Patients With Locally Advanced or Metastatic Head and Neck Squamous Cell Carcinoma
- A Study of SI-B001+SI-B003± Chemotherapy in the Treatment of Locally Advanced or Metastatic Non-small Cell Lung Cancer
- A Study of SI-B003 and BL-B01D1+SI-B003 in Patients With Locally Advanced or Metastatic Non-small Cell Lung Cancer, Nasopharyngeal Carcinoma and Other Solid Tumors
- A Study of SI-B003 and BL-B01D1+SI-B003 in Patients With Locally Advanced or Metastatic Urothelial Carcinoma and Other Solid Tumors
- A Study of SI-B003 or BL-B01D1+SI-B003 in Patients With Unresectable Locally Advanced or Recurrent Metastatic HER2 Negative Breast Cancer
- A Study of SI-B003, a PD-1/CTLA-4 Bispecific Antibody, in Patients With Advanced Solid Tumors
- A Study of SI-B003, BL-B01D1+SI-B003 and BL-B01D1+PD-1 Monoclonal Antibody in Patients With Locally Advanced or Metastatic Esophageal Cancer, Gastric Cancer, Colorectal Cancer and Other Gastrointestinal Tumors
In development for (1)
- Neoplasm Phase 2