Cagrilintide
Highest phase reached
Phase 3
Drug type
Protein
- Listing at source
- Listed
- Highest phase reached
- Phase 3
- Drug type
- Protein
- Drug name
- Cagrilintide
- cagrilintide component of cagrisema
- Cagrilintide component of cagrisema
- cagrilintide
- Cagrilintide
- cagrilintide [INN]
- CAGRILINTIDE [USAN]
- Cagrilintide [WHO-DD]
- Cagrilintide 2.4 mg
- cagrilintide inn
- cagrilintide usan
- cagrilintide who dd
- cagrisema component cagrilintide
- CagriSema component Cagrilintide
- nnc0174 0833
- NNC0174 0833
- NNC0174-0833
- CAS registry numbers
- 1415456-99-3
- ChEMBL ID
- CHEMBL4802169
- FDA ingredient codes (UNII)
- AO43BIF1U8
- First in class
- No
- Orphan designation
- No
- Pharmacology name
- cagrilintide
- Type
- Peptide
- Drug name stem
- -tide
- Action
- Agonist
- Action type
- Agonist
- Target
- AMY3 receptor
- Gene symbol
- RAMP3
- Protein identifier
- O60896
- Median affinity
- 9.46
- Affinity units
- pEC50
- Action
- Agonist
- Action type
- Agonist
- Target
- AMY3 receptor
- Gene symbol
- RAMP3
- Protein identifier
- O60896
- Median affinity
- 9.77
- Affinity units
- pIC50
- Action
- Agonist
- Action type
- Agonist
- Target
- AMY3 receptor
- Gene symbol
- CALCR
- Protein identifier
- P30988
- Median affinity
- 9.46
- Affinity units
- pEC50
- Action
- Agonist
- Action type
- Agonist
- Target
- CT receptor
- Gene symbol
- CALCR
- Protein identifier
- P30988
- Median affinity
- 9.54
- Affinity units
- pEC50
- Action
- Agonist
- Action type
- Agonist
- Target
- CT receptor
- Gene symbol
- CALCR
- Protein identifier
- P30988
- Median affinity
- 9.64
- Affinity units
- pIC50
- Action
- Agonist
- Action type
- Agonist
- Target
- AMY3 receptor
- Gene symbol
- CALCR
- Protein identifier
- P30988
- Median affinity
- 9.77
- Affinity units
- pIC50
- Condition
- Cardiovascular Diseases
- Highest recorded phase
- 3
- Condition identifier
- EFO:0000319
- Subject identifier
- D002318
- Condition
- Nutrition Disorders
- Highest recorded phase
- 1
- Condition identifier
- EFO:0001069
- Subject identifier
- D009748
- Condition
- Obesity
- Highest recorded phase
- 3
- Condition identifier
- EFO:0001073
- Subject identifier
- D009765
- Condition
- Liver Diseases
- Highest recorded phase
- 2
- Condition identifier
- EFO:0001421
- Subject identifier
- D008107
- Condition
- Overweight
- Highest recorded phase
- 1
- Condition identifier
- EFO:0005935
- Subject identifier
- D050177
- Condition
- Diabetes Mellitus, Type 2
- Highest recorded phase
- 3
- Condition identifier
- MONDO:0005148
- Subject identifier
- D003924
- Condition identifier
- EFO_0000319
- Highest recorded phase
- 3
- Condition identifier
- EFO_0001073
- Highest recorded phase
- 3
- Condition identifier
- EFO_0001421
- Highest recorded phase
- 2
- Condition identifier
- EFO_0005935
- Condition identifier
- HP_0001513
- Highest recorded phase
- 3
- Condition identifier
- HP_0003074
- Highest recorded phase
- 3
- Condition identifier
- HP_0004324
- Highest recorded phase
- 3
- Condition identifier
- HP_0025502
- Highest recorded phase
- 3
- Condition identifier
- MONDO_0005148
- Highest recorded phase
- 3
- Condition identifier
- MONDO_0005154
- Highest recorded phase
- 2
- Condition identifier
- MONDO_0005300
- Highest recorded phase
- 2
- Condition identifier
- MONDO_0007027
- Highest recorded phase
- 2
- Condition identifier
- MONDO_0011122
- Highest recorded phase
- 3
- NCT02300844
- NCT02958085
- NCT03600480
- NCT03787225
- NCT03856047
- NCT04074174
- NCT04209049
- NCT04940078
- NCT05804162
- NCT05813925
- NCT05996848
- NCT06207877
- NCT06267092
- NCT04982575
- NCT06065540
- NCT06221969
- NCT06323161
- NCT06323174
- NCT06403761
- NCT05564104
- NCT06409130
- NCT05669755
- Prodrug
- No
- Chirality
- Single enantiomer
- Inorganic
- No
- Natural product
- No
Sequences
- Component
- Sequence
- Type
- Protein
- Sequence
- XKCNTATCATQRLAEFLRHSSNNFGPILPPTNVGSNTP
Related records
Trials (49)
- A Research Study Looking at How a Single Dose of the Medicine Cagrilintide Works in Participants With Reduced Liver Function and in Healthy Participants With Normal Liver Function and How Cagrilintide is Absorbed and Used by the Body
- A Research Study Looking at How Cagrilintide Works on the Heart Rhythm in Healthy Participants
- A Research Study Looking Into Blood Levels of NNC0174-0833 in People With Normal and Impaired Kidney Function
- A Research Study Looking Into How Cagrilintide Influences Food Intake and Appetite in People With Overweight or Obesity
- A Research Study of How NNC0174-0833 Behaves in Chinese Volunteers Who Are Normal Weight, Overweight or With Obesity
- A Research Study of How NNC0174-0833 Behaves in Japanese and Caucasian Volunteers Who Are Normal Weight, Overweight or With Obesity
- A Research Study of How NNC0174-0833 Taken With Semaglutide Works in People Who Are Overweight or Obese
- A Research Study on How Well Cagrilintide and CagriSema Work in Children and Adolescents With Excess Body Weight
- A Research Study to Compare Blood Levels of Cagrilintide After Multiple Doses of Different Versions of Cagrilintide in Adults With Overweight or Obesity
- A Research Study to Compare Blood Levels of Cagrilintide and Semaglutide After Combined Versus Separate Injections in People With Overweight or Obesity
- A Research Study to Compare Blood Levels of Cagrilintide and Semaglutide After Single Doses of Different Versions of Injectable CagriSema in Adults With Overweight or Obesity
- A Research Study to Compare Blood Levels of Two Different Versions of Cagrilintide in Adults With Excess Body Weight
- A Research Study to Compare Two Different Versions of Injectable Cagrilintide and Placebo in People With Excess Body Weight
- A Research Study to Investigate the Effects of CagriSema Compared to Placebo in People With Type 2 Diabetes and Painful Diabetic Peripheral Neuropathy
- A Research Study to Look at How CagriSema Influences Food Intake, Appetite and Emptying of the Stomach in People With Excess Body Weight
- A Research Study to Look at How Well CagriSema Helps People Living With Obesity Lose Weight and Maintain Weight Loss in the Long-term
- A Research Study to Look Into the Long-term Effect on Weight Loss of CagriSema in People With Obesity
- A Research Study to See How Much CagriSema Lowers Blood Sugar and Body Weight Compared to Placebo in Children and Adolescents With Type 2 Diabetes
- A Research Study to See How Much CagriSema Lowers Blood Sugar and Body Weight Compared to Placebo in People With Type 2 Diabetes Treated With Diet and Exercise
- A Research Study to See How Much CagriSema Lowers Blood Sugar and Body Weight Compared to Placebo in People With Type 2 Diabetes Treated With Once-daily Basal Insulin With or Without Metformin
In development for (5)
- Cardiovascular disorder Phase 3
- Liver disorder Phase 2
- Nutritional disorder Phase 1
- Obesity disorder Phase 3
- Type 2 diabetes mellitus Phase 3