Cafelkibart
Highest phase reached
Phase 2
Drug type
Antibody
- Listing at source
- Listed
- Highest phase reached
- Phase 2
- Drug type
- Antibody
- Drug name
- Cafelkibart
- cafelkibart
- Cafelkibart
- cafelkibart [INN]
- cafelkibart inn
- h gamma1 heavy chain 1 453 vh musmus homsap mus musculus ighv10 1 02 92 9 ighd ighj4 01 93 8 s123 l 118 homo sapiens ighv3 73 01 88 0 ighd ighj4 01 100 cdr imgt 8 10 14 26 33 51 60 99 112 1 123 homo sapiens ighg1 01 g1m17 1 ch1 k120 ch3 d12 l14 g1v7 ch2 d3 e117 ch1 k120 220 124 221 hinge 1 15 222 236 ch2 s3 d 245 i117 e 338 237 346 ch3 d12 362 l14 364 347 451 chs 452 453 124 453 226 219 disulfide with l kappa light chain 1 219 v kappa musmus homsap mus musculus igkv2 137 01 91 0 igkj4 01 91 7 s120 q 115 homo sapiens igkv2 28 01 87 0 igkj2 02 100 cdr imgt 11 3 9 27 37 55 57 94 102 1 112 homo sapiens igkc 01 100 km3 a45 1 158 v101 196 113 219 dimer 232 232 235 235 bisdisulfide produced in chinese hamster ovary cho cells cell line cho k1 glycoform alfa
- H-gamma1 heavy chain (1-453) [VH Musmus/Homsap (Mus musculus IGHV10-1*02 (92.9%) -(IGHD) -IGHJ4*01 (93.8%) S123>L (118)/Homo sapiens IGHV3-73*01 (88.0%) -(IGHD) -IGHJ4*01 (100%), CDR-IMGT [8.10.14] (26-33.51-60.99-112)) (1-123) -Homo sapiens IGHG1*01, G1m17,1 CH1 K120, CH3 D12, L14, G1v7 CH2 D3, E117 (CH1 K120 (220) (124-221), hinge 1-15 (222-236), CH2 S3>D (245), I117>E (338) (237-346), CH3 D12 (362), L14 (364) (347-451), CHS (452-453)) (124-453)], (226-219')-disulfide with L-kappa light chain (1'-219') [V-KAPPA Musmus/Homsap (Mus musculus IGKV2-137*01 (91.0%) -IGKJ4*01 (91.7%) S120>Q (115')/Homo sapiens IGKV2-28*01 (87.0%) -IGKJ2*02 (100%), CDR-IMGT [11.3.9] (27'-37'.55'-57'.94'-102')) (1'-112') -Homo sapiens IGKC*01 (100%), Km3 A45.1 (158'), V101 (196') (113'-219')]; dimer (232-232'':235-235'')-bisdisulfide, produced in Chinese hamster ovary (CHO) cells, cell line CHO-K1, glycoform alfa
- Immunoglobulin G1 [245-aspartic acid,338-glutamic acid], anti-(human CC chemokine receptor CCR8) (human-Mus musculus monoclonal LM-108 γ1-chain), disulfide with human-Mus musculus monoclonal LM-108 κ-chain, dimer
- immunoglobulin g1 245 aspartic acid 338 glutamic acid anti human cc chemokine receptor ccr8 human mus musculus monoclonal lm 108 γ1 chain disulfide with human mus musculus monoclonal lm 108 κ chain dimer
- immunoglobulin g1 kappa anti homo sapiens ccr8 c c motif chemokine receptor 8 ckr l1 cdw198
- immunoglobulin G1-kappa, anti-[Homo sapiens CCR8 (C-C motif chemokine receptor 8, CKR-L1, CDw198)]
- lm 108
- Lm-108
- LM-108
- LM-108 injection
- lm108
- LM108
- CAS registry numbers
- 2851855-89-3
- ChEMBL ID
- CHEMBL6068098
- FDA ingredient codes (UNII)
- YN4XWR5BUJ
- First in class
- No
- Orphan designation
- No
- Drug name stem
- -bart
Investigated indications
- Condition
- Neoplasms
- Highest recorded phase
- 2
- Condition identifier
- EFO:0000616
- Subject identifier
- D009369
- Condition identifier
- EFO_0000616
- Condition identifier
- MONDO_0001056
- Highest recorded phase
- 3
- Condition identifier
- MONDO_0003219
- Highest recorded phase
- 3
- Condition identifier
- MONDO_0005070
- Condition identifier
- MONDO_0005233
- Highest recorded phase
- 2
- Condition identifier
- MONDO_0007254
- Highest recorded phase
- 2
- Condition identifier
- MONDO_0009831
- Highest recorded phase
- 1
- NCT05199753
- NCT05255484
- NCT05518045
- Prodrug
- No
- Chirality
- Single enantiomer
- Inorganic
- No
- Natural product
- No
- Component
- Heavy chain
- Type
- Protein
- Sequence
- EVQLVESGGGLVQPGGSLKLSCAASGFTFNTYAMNWVRQASGKGLEWVARIRSKANNYATYYADSVKDRFTISRDDSKNTLYLQMNNLKTEDTAVYYCVRDRSRGEDYAMDYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPDVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPEEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
- Component
- Disulfide bridges
- Sequence
- 22-98 $ 22''-98'' $ 23'-93' $ 23'''-93''' $ 139'-199' $ 139'''-199''' $ 150-206 $ 150''-206'' $ 226-219' $ 226''-219''' $ 232-232'' $ 235-235'' $ 267-327 $ 267''-327'' $ 373-431 $ 373''-431''
- Component
- Light chain
- Type
- Protein
- Sequence
- DIVMTQSPLSLPVTPGEPASISCRSSKSLLHSNANTYLYWFLQKPGQSPQLLIYRMSNLASGVPDRFSGSGSGTAFTLKISRVEAEDVGVYYCMQHLEYPFTFGQGTKLEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC
- Component
- Glycosylation sites (N)
- Sequence
- 303 $ 303''
Related records
Trials (10)
- A Study of LM-108 as Monotherapy or in Combination With Antitumor Therapies in Subjects With Advanced Solid Tumors
- A Study of LM-108 in Combination With Toripalimab in Subjects With Advanced Solid Tumours
- Clinical Studies for the Treatment of Advanced Solid Tumors
- Clinical Study Evaluating the Safety, Tolerability, and Preliminary Efficacy of LM-108 ± Penpulimab+Chemotherapy in Advanced Solid Tumors - Cohort C
- Efficacy of PD-1 Inhibitor Combination Therapy in Non-small Cell Lung Cancer Patients Who Have Not Achieved Major Pathologic Response After Neoadjuvant Immunotherapy: a Multicenter, Phase II Clinical Trial
- LM-108 Antibody Combination With Sintilimab for Locally Advanced or Metastatic Non-Small Cell Lung Cancer
- LM-108 in Combination With PD-1 Based Treatment for Patients With Recurrent or Metastatic Triple - Negative Breast Cancer
- LM-108 in Combination With Toripalimab Versus Paclitaxel Injection for the Treatment of Subjects With CCR8-Positive Gastric and Gastroesophageal Junction Adenocarcinoma
- Study of LM-108 as a Single Agent or in Combination With Anti-PD-1 Antibody in Subjects With Advanced Solid Tumours
- Study of LM-108 as a Single Agent or in Combination With Pembrolizumab in Subjects With Advanced Solid Tumours
In development for (1)
- Neoplasm Phase 2