Bofanglutide
Highest phase reached
Phase 2
Drug type
Protein
- Listing at source
- Listed
- Highest phase reached
- Phase 2
- Drug type
- Protein
- Drug name
- Bofanglutide
- 7 37 glucagon like peptide 1 8 glycine 26 n6 22s 22 44 dicarboxy 1 10 19 24 tetraoxo 3 6 12 15 tetraoxa 9 18 23 triazatetratetracont 1 yl l lysine 34 arginine human
- 7-37-Glucagon-like peptide 1 [8-glycine,26-[N6-[(22S)-22,44-dicarboxy-1,10,19,24-tetraoxo-3,6,12,15-tetraoxa-9,18,23-triazatetratetracont-1-yl]-L-lysine],34-arginine] (human)
- bofanglutida
- Bofanglutida
- bofanglutide
- Bofanglutide
- bofanglutide [INN]
- BOFANGLUTIDE [USAN]
- Bofanglutide [WHO-DD]
- bofanglutide inn
- bofanglutide usan
- bofanglutide who dd
- glr1033
- GLR1033
- gzr18
- GZR18
- GZR18 injection
- l histidylglycyl l α glutamylglycyl l threonyl l phenylalanyl lthreonyl l seryl l α aspartyl l valyl l seryl l seryl l tyrosyl l leucyl l α glutamylglycyl l glutaminyl l alanyl l alanyl n6 22s 22 44 dicarboxy 10 19 24 trioxo 3 6 12 15 tetraoxa 9 18 23 triazatetratetracontan 1 oyl l lysyl l α glutamyl l phenylalanyl lisoleucyl l alanyl l tryptophyl l leucyl l valyl l arginylglycyl larginylglycine
- L-histidylglycyl-L-α-glutamylglycyl-L-threonyl-L-phenylalanyl-Lthreonyl-L-seryl-L-α-aspartyl-L-valyl-L-seryl-L-seryl-L-tyrosyl-L-leucyl-L-α-glutamylglycyl-L-glutaminyl-L-alanyl-L-alanyl-N6-[(22S)-22,44-dicarboxy-10,19,24-trioxo-3,6,12,15-tetraoxa-9,18,23-triazatetratetracontan-1-oyl]-L-lysyl-L-α-glutamyl-L-phenylalanyl-Lisoleucyl-L-alanyl-L-tryptophyl-L-leucyl-L-valyl-L-arginylglycyl-Larginylglycine
- CAS registry numbers
- 2668298-70-0
- ChEMBL ID
- CHEMBL6068096
- FDA ingredient codes (UNII)
- X9RLV48FDH
- First in class
- No
- Orphan designation
- No
- Drug name stem
- -tide
- Condition identifier
- HP_0001513
- Highest recorded phase
- 2
- Condition identifier
- HP_0025502
- Highest recorded phase
- 2
- Prodrug
- No
- Chirality
- Single enantiomer
- Inorganic
- No
- Natural product
- No
Sequences
- Component
- Sequence
- Type
- Protein
- Sequence
- HGEGTFTSDVSSYLEGQAAKEFIAWLVRGRG
Related records
Trials (25)
- A Phase I Clinical Study to Evaluate the Effect of GZR18 Injection on the Pharmacokinetics of Oral Metformin Hydrochloride Tablets in Overweight/Obese Subjects
- A Phase I Study of GZR18 Injection in Healthy Subjects
- A Phase I Study of GZR18 Injection in Obese/Overweight Subjects
- A Phase I Study to Evaluate the PK and PD Profiles of GZR102 Injection Versus GZR4 Injection and GZR18 Injection Given Separately in Chinese Adult Overweight Subjects
- A Phase III Clinical Study to Evaluate the Efficacy and Safety of GZR18 Injection in Adult Obese/Overweight Subjects
- A Phase III Clinical Study to Evaluate the Efficacy and Safety of GZR18 Injection in Adult Type 2 Diabetes Mellitus
- A Phase III Clinical Study to Evaluate the Efficacy and Safety of GZR18 Injection in Subjects With Type 2 Diabetes Mellitus and Poor Blood Glucose Control by Diet and Exercise
- A Study of GZR18 Injection in Chinese Adult Patients With Type 2 Diabetes Mellitus (T2DM)
- A Study of GZR18 Injection in Chinese Obese/Overweight Patients
- A Study of GZR18 Injection in Chinese Patients With Type 2 Diabetes Mellitus
- A Study of GZR18 Injection in Obese/Overweight Patients
- A Study of GZR18 Tablet in Chinese Healthy Subjects
- A Study to Compare the Efficacy and Safety of GZR102 Injection and GZR18 Injection in Type 2 Diabetes Mellitus
- BALANCE-DM2 Study of Bofanglutide in Adults With Type 2 Diabetes
- BALANCE-OBS: Bofanglutide (GZR18) Versus Semaglutide in Latin American Adults With Overweight or Obesity
- Bioequivalence Study of GZR18 Injection Before and After CMC Change
- Efficacy and Safety of GZR18 Every 2 Weeks Versus Tirzepatide and Placebo in Obese or Overweight Participants
- Evaluate the Efficacy and Safety of GZR18 Injection in Obese Subjects With Obstructive Sleep Apnea Not Treated With Positive Airway Pressure (PAP) Therapy
- Evaluate the Efficacy and Safety of GZR18 Injection in Obese Subjects With Obstructive Sleep Apnea Receiving Positive Airway Pressure (PAP) Therapy
- Extension Study of the Phase 3 Clinical Study of GZR18 Injection for Weight Loss