Berahyaluronidase alfa
Highest phase reached
Phase 2
Drug type
Enzyme
- Listing at source
- Listed
- Highest phase reached
- Phase 2
- Drug type
- Enzyme
- Drug name
- Berahyaluronidase alfa
- 3 305 hyaluronidase ph 20 human fusion protein with 303 322 hyaluronidase hyal 1 human fusion protein with 327 433 hyaluronidase ph 20 human
- 3-305-Hyaluronidase PH-20 (human) fusion protein with 303-322-hyaluronidase HYAL-1 (human) fusion protein with 327-433-hyaluronidase PH-20 (human)
- alt b4
- ALT-B4
- berahyaluronidasa alfa
- Berahyaluronidasa alfa
- berahyaluronidase alfa
- Berahyaluronidase alfa
- berahyaluronidase alfa [INN]
- BERAHYALURONIDASE ALFA [USAN]
- Berahyaluronidase alfa [WHO-DD]
- berahyaluronidase alfa inn
- berahyaluronidase alfa usan
- berahyaluronidase alfa who dd
- human hyaluronidase isozyme 5 hyal5 sperm adhesion molecule 1 spam1 hyaluronidase ph 20 ec 3 2 1 35 fragment 3 433 1 431 in the current sequence engineered variant with the structural domain replaced by the corresponding region of human hyaluronidase isozyme 1 hyal1 sup 306 sup tlsimrsmkscllddnymeti sup 326 sup sup 304 sup swentrtkescqaikeymdtt sup 324 sup produced in chinese hamster ovary cho cells cell line dg44 glycoform alfa
- human hyaluronidase isozyme-5 (HYAL5, sperm adhesion molecule 1, SPAM1, hyaluronidase PH-20, EC:3.2.1.35) fragment (3-433, 1-431 in the current sequence) engineered variant with the structural domain replaced by the corresponding region of human hyaluronidase isozyme-1 (HYAL1)(<sup>306</sup>TLSIMRSMKSCLLDDNYMETI<sup>326</sup>><sup>304</sup>SWENTRTKESCQAIKEYMDTT<sup>324</sup>), produced in Chinese hamster ovary (CHO) cells, cell line DG44, glycoform alfa
- keytruda qlex component berahyaluronidase alfa
- KEYTRUDA QLEX COMPONENT Berahyaluronidase Alfa
- pembrolizumab and berahyaluronidase alfa
- pembrolizumab berahyaluronidase alfa
- CAS registry numbers
- 2636716-20-4
- ChEMBL ID
- CHEMBL5314725
- RxNorm IDs (RxCUI)
- 2723752
- FDA ingredient codes (UNII)
- 9X4R4A4HQQ
- First in class
- No
- Orphan designation
- No
- Pharmacology name
- pembrolizumab
- Type
- Antibody
- Drug name stem
- -ase
- Condition identifier
- EFO_1001927
- Highest recorded phase
- 2
- Condition identifier
- MONDO_0005086
- Highest recorded phase
- 1
- Condition identifier
- MONDO_0005105
- Highest recorded phase
- 1
- Condition identifier
- MONDO_0005233
- Highest recorded phase
- 3
- Condition identifier
- MONDO_0008903
- Highest recorded phase
- 3
- Condition identifier
- MONDO_0009348
- Highest recorded phase
- 2
- Prodrug
- No
- Chirality
- Single enantiomer
- Inorganic
- No
- Natural product
- No
- Component
- Glycosylation sites (N)
- Sequence
- 45 $ 129 $ 198 $ 217 $ 331 $ 356
- Component
- Sequence
- Type
- Protein
- Sequence
- FRAPPVIPNVPFLWAWNAPSEFCLGKFDEPLDMSLFSFIGSPRINATGQGVTIFYVDRLGYYPYIDSITGVTVNGGIPQKISLQDHLDKAKKDITFYMPVDNLGMAVIDWEEWRPTWARNWKPKDVYKNRSIELVQQONVQLSLTEATEKAKQEFEKAGKDFLVETIKLGKLLRPNHLWGYYLFPDCYNHHYKKPGYNGSCFNVEIKRNDDLSWLWNESTALYPSIYLNTQQSPVAATLYVRNRVREAIRVSKIPDAKSPLPVFAYTRIVFTDQVLKFLSQDELVYTFGETVALGASGIVIWGSWENTRTKESCQAIKEYMDTTLNPYIINVTLAAKMCSQVLCQEQGVCIRKNWNSSDYLHLNPDNFAIQLEKGGKFTVRGKPTLEDLEQFSEKFYCSCYSTLSCKEKADVKDTDAVDVCIADGVCIDAF
- Component
- Disulfide bridges
- Sequence
- 23-314 $ 187-201 $ 339-350 $ 344-398 $ 400-406 $ 421-427
- 0006-3083
- 0006-5083
Related records
Trials (14)
- A Clinical Study of Calderasib (MK-1084) and Other Treatments for Participants With Non-Small Cell Lung Cancer (MK-1084-007/KANDLELIT-007)
- A Clinical Study of Pembrolizumab (+) Berahyaluronidase Alfa (MK-3475A) to Treat Newly-diagnosed Metastatic Non-small Cell Lung Cancer (MK-3475A-F84)
- A Clinical Trial of Adjuvant Intismeran (V940) With or Without Pembrolizumab Coformulated With Berahyaluronidase Alfa (MK-3475A) in High-Risk Stage I Non-Small Cell Lung Cancer (V940-014)
- A Clinical Trial of Sacituzumab Tirumotecan (Sac-TMT, MK-2870) and Pembrolizumab (MK-3475A) in Participants With Bladder Cancer (MK-2870-055)
- A Study of Participant Reported Preference for Subcutaneous Pembrolizumab Coformulated With Berahyaluronidase Alfa (MK-3475A) Over Intravenous Pembrolizumab (MK-3475) Formulation in Multiple Tumor Types (MK-3475A-F11)
- A Study of Pembrolizumab (+) Berahyaluronidase Alfa (MK-3475A) (Pembrolizumab Formulated With Berahyaluronidase Alfa (MK-5180)) in Japanese Participants With Recurrent or Metastatic Cutaneous Squamous Cell Carcinoma (R/M cSCC) or Locally Advanced (LA) Unresectable cSCC (MK-3475A-E39)
- A Study of Subcutaneous (SC) Pembrolizumab Coformulated With Berahyaluronidase Alfa (MK-3475A) vs Intravenous Pembrolizumab in Adult Participants With Metastatic Non-small Cell Lung Cancer (NSCLC) (MK-3475A-D77)
- A Study of Subcutaneous (SC) Pembrolizumab Coformulated With Berahyaluronidase Alfa (MK-3475A) vs Intravenous Pembrolizumab in Adult Participants With Metastatic Non-small Cell Lung Cancer (NSCLC) (MK-3475A-D77)-Japan Extension
- A Study to Evaluate the Bioavailability of Pembrolizumab (MK-3475) Via Subcutaneous (SC) Injection of Pembrolizumab Formulated With Berahyaluronidase Alfa (MK-5180) [MK-3475A] In Advanced Solid Tumors (MK-3475A-C18)
- A Study to Evaluate the Safety and Efficacy of Pembrolizumab (MK-3475) Coformulated With Berahyaluronidase Alfa (MK-3475A) in Participants With Relapsed or Refractory Classical Hodgkin Lymphoma (rrcHL) or Relapsed or Refractory Primary Mediastinal Large B-cell Lymphoma (rrPMBCL)(MK-3475A-F65)
- Effect of Tergase Injection on Reducing Edema After Bilateral Total Knee Arthroplasty
- Long-term Safety and Efficacy Extension Study for Participants With Advanced Tumors Who Are Currently on Treatment or in Follow-up in a Pembrolizumab (MK-3475) Study (MK-3475-587/KEYNOTE-587)
- Pharmacokinetics and Tolerability of Subcutaneous Dupilumab Coformulated With Berahyaluronidase Alfa and Dupilumab Without Berahyaluronidase Alfa in Healthy Participants
- Zanzalintinib Alone or in Combination With Pembrolizumab and Berahyaluronidase Alfa in Participants With Colorectal Cancer With Molecular Residual Disease
In development for (5)
- Classic Hodgkin lymphoma Phase 2
- Lung cancer Phase 3
- Melanoma Phase 1
- Non-small cell lung carcinoma Phase 3
- Renal cell carcinoma Phase 1