Belrestotug
Highest phase reached
Phase 3
Drug type
Antibody
- Listing at source
- Listed
- Highest phase reached
- Phase 3
- Drug type
- Antibody
- Drug name
- Belrestotug
- belrestotug
- Belrestotug
- belrestotug [INN]
- BELRESTOTUG [USAN]
- Belrestotug [WHO-DD]
- belrestotug inn
- belrestotug usan
- belrestotug who dd
- Belrestotug.
- clone 31282
- Clone 31282
- eos 448
- eos 884448
- EOS-448
- Eos-884448
- EOS-884448
- eos884448
- Eos884448
- EOS884448
- gsk 4428859a
- GSK-4428859A
- gsk4428859a
- GSK4428859A
- immunoglobulin g1 anti human receptor tigit human monoclonal eos884448 gamma 1 chain disulfide with human monoclonal eos884448 kappa chain dimer
- IMMUNOGLOBULIN G1, ANTI-(HUMAN RECEPTOR TIGIT) (HUMAN MONOCLONAL EOS884448 .GAMMA.1-CHAIN), DISULFIDE WITH HUMAN MONOCLONAL EOS884448 .KAPPA.-CHAIN, DIMER
And 8 more, listed on the interactive page.
- CAS registry numbers
- 2574438-65-4
- ChEMBL ID
- CHEMBL4802205
- FDA ingredient codes (UNII)
- 59HAW3EQ4C
- First in class
- No
- Orphan designation
- No
- Condition
- Neoplasms
- Highest recorded phase
- 2
- Condition identifier
- EFO:0000616
- Subject identifier
- D009369
- Condition
- Multiple Myeloma
- Highest recorded phase
- 1
- Condition identifier
- EFO:0001378
- Subject identifier
- D009101
- Condition
- Carcinoma, Non-Small-Cell Lung
- Highest recorded phase
- 3
- Condition identifier
- EFO:0003060
- Subject identifier
- D002289
- Condition
- Head and Neck Neoplasms
- Highest recorded phase
- 2
- Condition identifier
- EFO:0005950
- Subject identifier
- D006258
- Condition
- Neoplasms
- Highest recorded phase
- 2
- Condition identifier
- MONDO:0004992
- Subject identifier
- D009369
- Condition identifier
- EFO_0000616
- Highest recorded phase
- 2
- Condition identifier
- MONDO_0004992
- Highest recorded phase
- 1
- Condition identifier
- MONDO_0005070
- Condition identifier
- MONDO_0005233
- Highest recorded phase
- 3
- Condition identifier
- MONDO_0009693
- Highest recorded phase
- 1
- Condition identifier
- MONDO_0010150
- Highest recorded phase
- 2
- NCT03739710
- NCT04446351
- NCT05277051
- NCT04335253
- NCT05289492
- NCT05565378
- NCT06472076
- NCT06062420
- Prodrug
- No
- Chirality
- Single enantiomer
- Inorganic
- No
- Natural product
- No
- Component
- Heavy chain
- Type
- Protein
- Sequence
- QVQLVQSGAEVKKPGASVKVSCKASGYTFTSYYMHWVRQAPGQGLEWMGVIGPSGASTSYAQKFQGRVTLTRDTSTSTVYMELSSLRSEDTAVYYCARDHSDYWSGIMEVWGQGTTVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
- Component
- Light chain
- Type
- Protein
- Sequence
- EIVLTQSPGTLSLSPGERATLSCRASQSVRSSYLAWYQQKPGQAPRLLIYGASSRATGIPDRFSGSGSGTDFTLTISRLEPEDFAVYYCQQYFSPPWTFGGGTKVEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC
- Component
- Disulfide bridges
- Sequence
- 22-96 $ 22''-96'' $ 23'-89' $ 23'''-89''' $ 135'-195' $ 135'''-195''' $ 148-204 $ 148''-204'' $ 215'-224 $ 215'''-224'' $ 230-230'' $ 233-233'' $ 265-325 $ 265''-325'' $ 371-429 $ 371''-429''
- Component
- Glycosylation sites (N)
- Sequence
- 301 $ 301''''
- Component
- Glycosylation sites (N)
- Sequence
- 301 $ 301''
Related records
Trials (10)
- A Platform Study of Novel Immunotherapy Combinations as First-Line Treatment in Participants With PD-L1 Positive Recurrent/Metastatic Squamous Cell Carcinoma of the Head and Neck- GALAXIES H&N-202
- A Platform Study of Novel Immunotherapy Combinations in Participants With Previously Untreated, Advanced/Metastatic Non-Small-Cell Lung Cancer
- A Study of Belrestotug Plus Dostarlimab Compared With Placebo Plus Pembrolizumab in Previously Untreated Participants With Programmed Death Ligand 1 (PD-L1) High Non-small-cell Lung Cancer (NSCLC)
- First-In-Human Study of EOS884448 in Participants with Advanced Cancers.
- First-Time-in-Human Study of GSK4381562 in Participants With Advanced Solid Tumors
- Platform Trial of Novel Regimens Versus Standard of Care (SoC) in Participants With Non-small Cell Lung Cancer (NSCLC)
- Platform Trial of Novel Regimens Versus Standard of Care (SoC) in Participants With Non-small Cell Lung Cancer (NSCLC) - Sub-study 3
- Study of EOS-448 With Standard of Care and/or Investigational Therapies in Participants With Advanced Solid Tumors
- Study of Novel Regimens in Relapsed or Refractory Multiple Myeloma
- Study of the Safety and Effectiveness of GSK6097608 in Participants With Advanced Solid Tumors
In development for (5)
- Cancer Phase 2
- Head and neck neoplasm Phase 2
- Neoplasm Phase 2
- Non-small cell lung carcinoma Phase 3
- Plasma cell myeloma Phase 1