Becotatug vedotin
Highest phase reached
Phase 3
Drug type
Antibody drug conjugate
- Listing at source
- Listed
- Highest phase reached
- Phase 3
- Drug type
- Antibody drug conjugate
- Drug name
- Becotatug vedotin
- adc
- ADC
- anti egfr adc mrg003
- anti egfr antibody drug conjugate mrg003
- Anti-egfr adc mrg003
- Anti-EGFR Antibody-drug Conjugate MRG003
- antibody drug conjugate (ADC) composed of a recombinant humanized anti-human Epidermal growth factor receptor (EGFR) monoclonal antibody JMT101 conjugated with the cytotoxic small molecule MMAE
- antibody drug conjugate adc composed of a recombinant humanized anti human epidermal growth factor receptor egfr monoclonal antibody jmt101 conjugated with the cytotoxic small molecule mmae
- Antibody-drug conjugate (ADC)
- Antibody-drug conjugate (ADC) combination therapy
- becotatug vedotin
- Becotatug vedotin
- Becotatug Vedotin
- Becotatug Vedotin (MRG003)
- becotatug vedotin [INN]
- Becotatug Vedotin for Injection
- becotatug vedotin inn
- becotatug vedotina
- Becotatug vedotina
- becotatug vedotine
- Becotatug vedotine
- h gamma1 heavy chain humanized 1 449 vh homo sapiens ighv4 4 08 79 4 ighd ighj4 01 92 9 cdr imgt 8 7 13 26 33 51 57 96 108 1 119 homo sapiens ighg1 03 100 g1m3 ng1m1 ch1 r120 216 120 217 hinge 1 15 218 232 ch2 233 342 ch3 e12 358 m14 360 343 447 chs 448 449 120 449 222 214 disulfide with l kappa light chain humanized 1 214 v kappa homo sapiens igkv6 21 02 89 5 igkj2 03 100 cdrimgt 6 3 9 27 32 50 52 89 97 1 107 homo sapiens igkc 01 100 km3 a45 1 v101 ckappa a45 1 153 v101 191 108 214 dimer 228 228 231 231 bisdisulfide produced in chinese hamster ovary cho cells cell line chos glycoform alfa substituted at the sulfur atoms of four l cysteinyl residues on an average among 222 228 231 214 222 228 231 and 214 with a group consisting of 3rs 1 6 2s 1 2s 5 carbamoylamino 1 4 2s 1 2s 1 3r 4s 5s 1 2s 2 1r 2r 3 1s 2r 1 hydroxy 1 phenylpropan 2 yl amino 1 methoxy 2 methyl 3 oxopropyl pyrrolidin 1 yl 3 methoxy 5 methyl 1 oxoheptan 4 yl methyl amino 3 methyl 1 oxobutan 2 yl amino 3 methyl 1 oxobutan 2 yl methyl carbamoyl oxy methyl anilino 1 oxopentan 2 yl amino 3 methyl 1 oxobutan 2 yl amino 6 oxohexyl 2 5 dioxopyrrolidin 3 yl vedotin
- H-gamma1 heavy chain humanized (1-449) [VH (Homo sapiens IGHV4-4*08 (79.4%) -(IGHD) -IGHJ4*01 (92.9%), CDR-IMGT [8.7.13] (26-33.51-57.96-108)) (1-119) -Homo sapiens IGHG1*03 (100%) G1m3, nG1m1 (CH1 R120 (216) (120-217), hinge 1-15 (218-232), CH2 (233-342), CH3 E12 (358), M14 (360) (343-447), CHS (448-449)) (120-449)], (222-214')-disulfide with L-kappa light chain humanized (1'-214') [V-KAPPA (Homo sapiens IGKV6-21*02 (89.5%) -IGKJ2*03 (100%), CDRIMGT [6.3.9] (27-32.50-52.89-97)) (1'-107') -Homo sapiens IGKC*01 (100%) Km3 A45.1, V101 (CKAPPA A45.1 (153'), V101 (191')) (108'-214')]; dimer (228-228'': 231-231'')-bisdisulfide, produced in Chinese hamster ovary (CHO) cells, cell line CHOS, glycoform alfa; substituted at the sulfur atoms of four L-cysteinyl residues on an average among 222, 228, 231, 214', 222'', 228'', 231'' and 214''' with a group consisting of (3RS)-1-(6-{[(2S)-1-{[(2S)-5-(carbamoylamino)-1-{4-[({[(2S)-1-{[(2S)-1-{[(3R,4S,5S)-1-{(2S)-2-[(1R,2R)-3-{[(1S,2R)-1-hydroxy-1-phenylpropan-2-yl]amino}-1-methoxy-2-methyl-3-oxopropyl]pyrrolidin-1-yl}-3-methoxy-5-methyl-1-oxoheptan-4-yl](methyl)amino}-3-methyl-1-oxobutan-2-yl]amino}-3-methyl-1-oxobutan-2-yl](methyl)carbamoyl}oxy)methyl]anilino}-1-oxopentan-2-yl]amino}-3-methyl-1-oxobutan-2-yl]amino}-6-oxohexyl)-2,5-dioxopyrrolidin-3-yl (vedotin)
- immunoglobulin g1 kappa anti homo sapiens egfr epidermal growth factor receptor receptor tyrosine protein kinase erbb 1 erbb1 her1 her 1 erbb humanized monoclonal antibody conjugated on an average of four cysteinyl residues to vedotin comprising a cleavable linker and monomethylauristatin e mmae
- Immunoglobulin G1-kappa, anti-[Homo sapiens EGFR (epidermal growth factor receptor, receptor tyrosine-protein kinase erbB-1, ERBB1, HER1, HER-1, ERBB)], humanized monoclonal antibody, conjugated on an average of four cysteinyl residues to vedotin, comprising a cleavable linker and monomethylauristatin E (MMAE)
And 10 more, listed on the interactive page.
- CAS registry numbers
- 2770851-80-2
- ChEMBL ID
- CHEMBL6068210
- FDA ingredient codes (UNII)
- VHA6L8H5FM
- First in class
- No
- Orphan designation
- No
- Pharmacology name
- becotatug vedotin
- Type
- Antibody
- Drug name stem
- -dotin
- Approval recorded by Guide to Pharmacology
- Yes
- Condition
- Carcinoma, Squamous Cell
- Highest recorded phase
- 3
- Condition identifier
- EFO:0000181
- Subject identifier
- D002294
- Condition
- Neoplasms
- Highest recorded phase
- 2
- Condition identifier
- EFO:0000616
- Subject identifier
- D009369
- Condition
- Carcinoma, Non-Small-Cell Lung
- Highest recorded phase
- 2
- Condition identifier
- EFO:0003060
- Subject identifier
- D002289
- Condition
- Nasopharyngeal Neoplasms
- Highest recorded phase
- 2
- Condition identifier
- EFO:0004252
- Subject identifier
- D009303
- Condition
- Biliary Tract Neoplasms
- Highest recorded phase
- 2
- Condition identifier
- MONDO:0003060
- Subject identifier
- D001661
- Condition identifier
- EFO_0000181
- Highest recorded phase
- 3
- Condition identifier
- EFO_0000616
- Condition identifier
- EFO_0003060
- Highest recorded phase
- 2
- Condition identifier
- EFO_1001927
- Highest recorded phase
- 2
- Condition identifier
- MONDO_0000521
- Highest recorded phase
- 2
- Condition identifier
- MONDO_0001056
- Highest recorded phase
- 2
- Condition identifier
- MONDO_0001325
- Highest recorded phase
- 2
- Condition identifier
- MONDO_0001402
- Highest recorded phase
- 2
- Condition identifier
- MONDO_0001528
- Highest recorded phase
- 2
- Condition identifier
- MONDO_0002974
- Highest recorded phase
- 2
- Condition identifier
- MONDO_0003060
- Highest recorded phase
- 2
- Condition identifier
- MONDO_0004669
- Highest recorded phase
- 2
- Condition identifier
- MONDO_0004958
- Highest recorded phase
- 2
- Condition identifier
- MONDO_0004971
- Highest recorded phase
- 2
- Condition identifier
- MONDO_0005070
- Condition identifier
- MONDO_0005096
- Highest recorded phase
- 2
- Condition identifier
- MONDO_0005233
- Highest recorded phase
- 2
- Condition identifier
- MONDO_0005575
- Highest recorded phase
- 2
- Condition identifier
- MONDO_0005580
- Highest recorded phase
- 2
- Condition identifier
- MONDO_0006382
- Highest recorded phase
- 2
- Condition identifier
- MONDO_0006468
- Highest recorded phase
- 2
- Condition identifier
- MONDO_0007256
- Highest recorded phase
- 2
- Condition identifier
- MONDO_0010150
- Highest recorded phase
- 3
- Condition identifier
- MONDO_0015459
- Highest recorded phase
- 3
- Condition identifier
- MONDO_0018352
- Highest recorded phase
- 2
And 2 more, listed on the interactive page.
- NCT04838548
- NCT04838964
- NCT04868162
- NCT05751512
- NCT04868344
- NCT05688605
- NCT05126719
- Prodrug
- No
- Chirality
- Single enantiomer
- Inorganic
- No
- Natural product
- No
- Component
- Heavy chain
- Type
- Protein
- Sequence
- QVQLQESGPGLVKPSETLSLTCTVSGFSLSNYDVHWVRQAPGKGLEWLGVIWSGGNTDYNTPFTSRLTISVDTSKNQFSLKLSSVTAADTAVYYCARALDYYDYEFAYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPKSCDKTHTCPPCPAPELLGGPSVFLEPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
- Component
- Disulfide bridges
- Sequence
- 22-95 $ 22''-95 $ 23'-88' $ 23'''-88''' $ 134'-194' $ 134'''-194''' $ 146-202 $ 146''-202'' $ 222-214' $ 222''-214''' $ 228-228'' $ 231-231'' $ 263-323 $ 263''-323'' $ 369-427 $ 369''-427''
- Component
- Light chain
- Type
- Protein
- Sequence
- EIVLTQSPDFQSVTPKEKVTITCRASQSIGTNIHWYQQKPDQSPKLLIKYASESISGIPSRFSGSGSGTDFTLTINSLEAEDAATYYCQQNNEWPTSFEGQGTKLEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC
- Component
- Glycosylation sites (N)
- Sequence
- 299 $ 299''
Related records
Trials (427)
- 211At-BC8-B10 Followed by Donor Stem Cell Transplant in Treating Patients With Relapsed or Refractory High-Risk Acute Leukemia or Myelodysplastic Syndrome
- ²¹¹At-OKT10-B10 and Fludarabine Alone or in Combination With Cyclophosphamide and Low-Dose TBI Before Donor Stem Cell Transplant for the Treatment of Newly Diagnosed, Recurrent, or Refractory High-Risk Multiple Myeloma
- 40.2Gy Versus 49.2Gy Radiotherapy in Low-Risk Target Volume for Chemosensitive Stage II Nasopharyngeal Carcinoma
- A Clinical Study of Omalizumab in the Treatment of Allergic Asthma(ESSENCE)
- A Clinical Trial on Autologous NK Cells Combined With GD2 Monoclonal Antibody in the Treatment of Children With Newly Diagnosed High-risk or Relapsed/Refractory Neuroblastoma
- A Clinical Trial to Test if the Investigational Drug BNT329 is Safe and Potentially Beneficial for People With Advanced Solid Tumors Known to Express the Tumor Marker CA19-9
- A First-in-Human Study of EOS301984 as Monotherapy or Combination Therapy in Adult Participants With Advanced Solid Tumors
- A Maintenance Extension of Phase I Pilot Study of Chimeric Anti-CD4 Antibody M-T412 in Patients With Multiple Sclerosis
- A Phase 1b/2 Study of the Safety and Efficacy of the Monoclonal Antibody OM-RCA-01 in Patients With Metastatic Tumors Expressing Fibroblast Growth Factor Receptor 1
- A Phase 3 Study of IN10018 in Combination With D-1553 Versus Standard Therapy for First Line Non-squamous Non-small Cell Lung Cancer With KRAS G12C Mutation
- A Phase I Clinical Study for Evaluating the Safety and Efficacy of MASCT-I in Patients With Advanced Solid Tumors
- A Phase I Clinical Study for Evaluating the Safety of MASCT-I in Advanced Soild Tumor
- A Phase I Trial Of The Humanized Anti-GD2 Antibody In Children And Adolescents With Neuroblastoma, Osteosarcoma, Ewing Sarcoma and Melanoma
- A Phase II Clinical Trial of Anti-EGFR Antibody-drug Conjugate (ADC) Combined With or Without Immune Checkpoint Inhibitors in the Neoadjuvant Treatment of Resectable Locally Advanced Head and Neck Squamous Cell Carcinoma
- A Phase II Study of Anti-EGFR Antibody-drug Conjugate (ADC) Combine With CDK4/6 Inhibitors Posterior Line in the Treatment of Recurrent/Metastatic CDKN2A Gene Variant Head and Neck Squamous Cell Carcinoma
- A Phase II Study of MRG003 Injection Combined With Pucotenlimab Injection ± Cisplatin Injection in the Neoadjuvant Treatment Locally Advanced EGFR-positive Head and Neck Squamous Cell Carcinoma
- A Phase II Study of PD-1/IL-2α-bias Bispecific Antibody Fusion Protein Monotherapy in Advanced Esophageal Squamous Cell Carcinoma After Failure of Prior ICI Plus Platinum-Based Chemotherapy
- A Phase II Study of SSGJ-612 Plus a HER2-Targeted ADC in HR-Positive, HER2-Low or HER2-Ultralow Expression Metastatic Breast Cancer
- A Phase II Trial Comparing Immunotherapy Versus Capecitabine Maintenance After Chemo-chemoradiotherapy for High-risk Nasopharyngeal Carcinoma
- A Phase II Trial of Camrelizumab in Combination With Apatinib for Neoadjuvant Treatment of Early-stage TNBC With a High Proportion of TILs
In development for (5)
- Biliary tract cancer Phase 2
- Head and neck squamous cell carcinoma Phase 3
- Nasopharyngeal neoplasm Phase 2
- Neoplasm Phase 2
- Non-small cell lung carcinoma Phase 2