Becotatug
Highest phase reached
Phase 2
Drug type
Antibody
- Listing at source
- Listed
- Highest phase reached
- Phase 2
- Drug type
- Antibody
- Drug name
- Becotatug
- becotatug
- Becotatug
- becotatug [INN]
- becotatug cetuximab
- becotatug inn
- gamma1 heavy chain humanized (1-449) [VH (Homo sapiens IGHV4-4*08 (79.4%)-(IGHD) -IGHJ4*01 (92.9%), CDR-IMGT [8.7.13] (26-33.51-57.96-108)) (1-119) -Homo sapiens IGHG1*03, G1m3, nG1m1 (CH1R120 (216) (120-217), hinge 1-15 (218-232), CH2 (233-342), CH3 E12 (358), M14 (360) (343-447), CHS (448-449)) (120-449)], (222-214')-disulfide with kappa light chain humanized (1'-214') [V-KAPPA (Homo sapiens IGKV6-21*02 (89.5%) -IGKJ2*03 (100%), CDR-IMGT [6.3.9] (27-32.50-52.89-97))(1'-107')-Homo sapiens IGKC*01 (100%), Km3 A45.1 (153), V101 (191) (108'-214')], dimer (228-228'': 231-231'')-bisdisulfide, produced in Chinese hamster ovary (CHO) cells, cell line CHO-S, glycoform alfa
- gamma1 heavy chain humanized 1 449 vh homo sapiens ighv4 4 08 79 4 ighd ighj4 01 92 9 cdr imgt 8 7 13 26 33 51 57 96 108 1 119 homo sapiens ighg1 03 g1m3 ng1m1 ch1r120 216 120 217 hinge 1 15 218 232 ch2 233 342 ch3 e12 358 m14 360 343 447 chs 448 449 120 449 222 214 disulfide with kappa light chain humanized 1 214 v kappa homo sapiens igkv6 21 02 89 5 igkj2 03 100 cdr imgt 6 3 9 27 32 50 52 89 97 1 107 homo sapiens igkc 01 100 km3 a45 1 153 v101 191 108 214 dimer 228 228 231 231 bisdisulfide produced in chinese hamster ovary cho cells cell line cho s glycoform alfa
- immunoglobulin g1 anti human epidermal growth factor receptor human mus musculus monoclonal jmt101 γ1 chain disulfide with human mus musculus monoclonal jmt101 κ chain dimer
- immunoglobulin g1 kappa anti homo sapiens egfr epidermal growth factor receptor receptor tyrosine protein kinase erbb 1 erbb1 her1 her 1 erbb humanized monoclonal antibody
- immunoglobulin G1-kappa, anti-[Homo sapiens EGFR (epidermal growth factor receptor, receptor tyrosine-protein kinase erbB-1, ERBB1, HER1, HER-1, ERBB)], humanized monoclonal antibody
- Immunoglobulin G1, anti-(human epidermal growth factor receptor) (human-Mus musculus monoclonal JMT101 γ1-chain), disulfide with human-Mus musculus monoclonal JMT101 κ-chain, dimer
- jmt 101
- Jmt 101
- JMT 101 [WHO-DD]
- jmt 101 who dd
- Jmt-101
- JMT-101
- jmt101
- Jmt101
- JMT101
- JMT101 (FULLY HUMAN MONOCLONAL IGG1 ANTIBODY TARGETING EPIDERMAL GROWTH FACTOR RECEPTOR (EGFR))
- jmt101 fully human monoclonal igg1 antibody targeting epidermal growth factor receptor egfr
- JMT101 injection
- JMT101 Injection
- CAS registry numbers
- 2648260-93-7
- ChEMBL ID
- CHEMBL4650481
- FDA ingredient codes (UNII)
- 981YA69AO3
- First in class
- No
- Orphan designation
- No
- Pharmacology name
- becotatug vedotin
- Type
- Antibody
- Condition
- Neoplasms
- Highest recorded phase
- 2
- Condition identifier
- EFO:0000616
- Subject identifier
- D009369
- Condition
- Carcinoma, Squamous Cell
- Highest recorded phase
- 1
- Condition identifier
- EFO:0000707
- Subject identifier
- D002294
- Condition
- Carcinoma, Non-Small-Cell Lung
- Highest recorded phase
- 2
- Condition identifier
- EFO:0003060
- Subject identifier
- D002289
- Condition identifier
- EFO_0000616
- Highest recorded phase
- 1
- Condition identifier
- EFO_0003060
- Condition identifier
- MONDO_0005070
- Condition identifier
- MONDO_0005233
- Highest recorded phase
- 3
- Condition identifier
- MONDO_0005575
- Highest recorded phase
- 3
- Condition identifier
- MONDO_0005580
- Highest recorded phase
- 1
- Condition identifier
- MONDO_0010150
- Highest recorded phase
- 2
- Condition identifier
- MONDO_0015459
- Highest recorded phase
- 2
- NCT04448379
- NCT05132777
- NCT06319313
- NCT04689100
- NCT05164848
- Prodrug
- No
- Inorganic
- No
- Natural product
- No
- Component
- Glycosylation sites (N)
- Sequence
- 299 $ 299'
- Component
- Heavy chain
- Type
- Protein
- Sequence
- QVQLQESGPGLVKPSETLSLTCTVSGFSLSNYDVHWVRQAPGKGLEWLGVIWSGGNTDYNTPFTSRLTISVDTSKNQFSLKLSSVTAADTAVYYCARALDYYDYEFAYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
- Component
- Disulfide bridges
- Sequence
- 22-95 $ 22''-95'' $ 23'-88' $ 23'''-88''' $ 134'-194' $ 134'''-194''' $ 146-202 $ 146''-202'' $ 222-214' $ 222''-214''' $ 228-228'' $ 231-231'' $ 263-323 $ 263''-323'' $ 369-427 $ 369''-427''
- Component
- Light chain
- Type
- Protein
- Sequence
- EIVLTQSPDFQSVTPKEKVTITCRASQSIGTNIHWYQQKPDQSPKLLIKYASESISGIPSRFSGSGSGTDFTLTINSLEAEDAATYYCQQNNEWPTSFGQGTKLEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC
Related records
Trials (12)
- A Clinical Study of JMT101 in Combination With Osimertinib Versus Osimertinib Alone as First-Line Treatment for Patients With Locally Advanced or Metastatic Non-Squamous Non-Small Cell Lung Cancer (NSCLC) Harboring Epidermal Growth Factor Receptor (EGFR) Sensitive Mutations
- A Study of JMT101 in Patients With Metastatic Colorectal Cancer
- Efficacy and Safety of JMT101 Combined With Afatinib (or Osimertinib) in Patients With Non-Small Cell Lung Cancer
- Efficacy and Safety of JMT101 Combined With Osimertinib in Patients With Non-Small Cell Lung Cancer
- Efficacy and Safety of JMT101 Combined Wth Docetaxel / HB1801 in Patients With Squamous Cell Non-Small Cell Lung Cancer
- Efficacy and Safety of JMT101 in Patients With Advanced Solid Tumor
- JMT101 Combined With Afatinib in Patients With Advanced Esophageal Squamous Cell Carcinoma After Standard Therapy
- JMT101 Combined With Mitoxantrone Liposome for Nasopharyngeal Cancer
- JMT101 Combined With Osimertinib in Patients With Stage Ⅲb-Ⅳ Non-small Cell Lung Cancer (NSCLC) Characterized by Epithermal Growth Factor Receptor (EGFR) Common Mutations
- JMT101 in Combination With Osimertinib, Versus Cisplatin-pemetrexed in Participants With Locally Advanced or Metastatic Non-small Cell Lung Cancer (NSCLC) Characterized by Epithermal Growth Factor Receptor (EGFR) Exon 20ins Mutations
- SYS6002 Plus JMT101 and Enlonstobart Injection in Participants With HNSCC
- The Study of JMT101 Combined With Irinotecan as a ≥3rd-Line Treatment in Metastatic Colorectal Cancer
In development for (3)
- Neoplasm Phase 2
- Non-small cell lung carcinoma Phase 2
- Squamous cell carcinoma Phase 1